close all open/close all

CDS information : Fred_00230


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction19,741 / 19,310 / - [in whole cluster]
19,741 / 19,310 / - [in contig]
Locationcomplement(19310..19741) [in whole cluster]
complement(19310..19741) [in contig]
TypeCDS
Length432 bp (143 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative MarR family transcriptional regulator
Product (GenBank)transcriptional regulator
GenefdmR
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • FdmR
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)
[18556785] Identification and utility of FdmR1 as a Streptomyces antibiotic regulatory protein activator for fredericamycin production in Streptomyces griseus ATCC 49344 and heterologous hosts. (J Bacteriol. , 2008)
Family/Domain
FD
IPR000835

close this sectionSequence

selected fasta
>putative MarR family transcriptional regulator [transcriptional regulator]
MIRIRRRQSRRSLARPVMKGLADPIDLNTLAVVDAVDEGGGQSGRDVTVGFIADRLAIDP
SRASRIVADAVRSGFIRRVASQEDGRRSCLELTPTGEEAVSAAHRTRQDFYGKVLGDWDE
GEQREFARLLTKFVHSLDEADHG
selected fasta
>putative MarR family transcriptional regulator [transcriptional regulator]
ATGATCCGGATCCGCCGCCGGCAGTCCCGGCGCAGCCTCGCGCGCCCCGTCATGAAGGGC
CTCGCGGACCCGATCGACCTCAACACCCTCGCCGTCGTGGACGCCGTCGACGAGGGCGGC
GGACAGAGCGGCCGCGACGTCACCGTCGGTTTCATCGCCGACCGCCTCGCCATCGACCCG
TCCCGGGCCAGCCGGATCGTCGCCGACGCCGTCAGGTCGGGCTTCATCCGCCGGGTGGCC
TCCCAGGAGGACGGCCGACGGAGCTGCCTGGAACTGACGCCCACCGGCGAAGAGGCCGTC
AGTGCCGCCCACCGCACCCGCCAGGACTTCTACGGCAAGGTGCTCGGGGACTGGGACGAG
GGCGAGCAGCGGGAGTTCGCCCGGCTGCTCACCAAGTTCGTCCACTCCCTGGACGAGGCG
GACCACGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000835 Transcription regulator HTH, MarR-type (Family)
 [1-135]  PS50995
PS50995   HTH_MARR_2
 [18-123]  2.79999889404114e-08 SM00347
SM00347   HTH_MARR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [22-137]  1.6e-25 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP
 [1-22]  0.475 Signal
Bacteria, Gram-positive   
 [1-14]  0.584 Signal
Bacteria, Gram-negative   
TMHMM No significant hit