close all open/close all

CDS information : Fred_00240


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction19,943 / 20,368 / + [in whole cluster]
19,943 / 20,368 / + [in contig]
Location19943..20368 [in whole cluster]
19943..20368 [in contig]
TypeCDS
Length426 bp (141 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
GenefdmU
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • FdmU
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MSATPAAETGGTVRTRAIALVGAVVLAALIWLLAHEAFGVDLRTPDGPGATTTSELPFAA
VPLSVLVVSLLGWALLALLERFTARARTVWTAVAGAVLVMSLFAPVFSEGLTAGNRLTLV
CLHLAVGAVLIPAYRKGARQA
selected fasta
>hypothetical protein [unknown]
ATGTCCGCAACTCCCGCCGCCGAAACCGGCGGAACCGTGCGCACCAGAGCGATCGCCCTC
GTGGGGGCCGTGGTGCTCGCCGCGCTGATCTGGCTCCTCGCCCACGAGGCGTTCGGGGTC
GACCTGAGGACCCCGGACGGCCCCGGTGCCACCACCACGAGCGAGCTGCCGTTCGCGGCC
GTGCCCCTCTCCGTCCTGGTGGTCTCCCTGCTGGGCTGGGCGCTGCTGGCCCTCCTGGAA
CGGTTCACCGCCCGGGCCCGCACCGTCTGGACCGCCGTCGCCGGGGCGGTGCTCGTGATG
TCCCTCTTCGCCCCGGTCTTCTCGGAGGGCCTGACCGCGGGCAACCGCCTCACGCTCGTC
TGCCTGCACCTGGCGGTCGGCGCGGTGCTGATCCCGGCGTACCGCAAGGGTGCCCGCCAG
GCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-39]  0.428 Signal
Bacteria, Gram-positive   
 [1-39]  0.949 Signal
Eukaryota   
TMHMM
 [13-35]  Transmembrane (i-o) [57-79]  Transmembrane (o-i) [86-108]  Transmembrane (i-o) [112-134]  Transmembrane (o-i)
Transmembrane 4