close all open/close all

CDS information : Fred_00250


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction20,468 / 22,336 / + [in whole cluster]
20,468 / 22,336 / + [in contig]
Location20468..22336 [in whole cluster]
20468..22336 [in contig]
TypeCDS
Length1,869 bp (622 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productamide synthetase
Product (GenBank)asparagine synthetase
GenefdmV
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • FdmV
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)
[20926388] Characterization of FdmV as an amide synthetase for fredericamycin A biosynthesis in Streptomyces griseus ATCC 43944. (J Biol Chem. , 2010)

close this sectionSequence

selected fasta
>amide synthetase [asparagine synthetase]
MCGIAGWVVRQDGRPREDPAVAEAMAGAMACRGPDEQGVRGGRHVTLVHTRMAVIDLLGG
RQPMAADESEDPAATLTYCGEIYNAAELRSDLAGRGHRFRTRSDTEVVLRAYLEWGERCP
ERLEGMFAFAVWDARTRSLFLARDRFGVKPLYYAETGDGLVFGSEPKALLVHSDVSPEVD
LDGLRVLFSMARAPGECVYRSLSDLPPAHTLRFGPDGRLSLRRYWQLEARPHEEDLAGTV
ATVRGLLESSVARELVSDVPLSVLLSGGLDSSTVAALAARALADGDGGPVRTTTVTYSGY
GDNFQPDLVRSAPDSPYARAVAEHIGAEHLEIELTTADLIDPVARRTVLRAQDVPAPFGD
MDTSTYQAFAGVRRHSRVALTGESADEIFGGYSWVHIPDLAHEEQFPWVAFEQWHPGTRR
GLGQGLLSPAFKDRLDMGSYYAERYAQAMSRIPRLPREGEEERRAREICDLHLTHWLPRL
LERNDRLSMVSGLEVRVPFCDHRLVQYAYNIPWAMKTFDGREKSVLRAAARDLLPERVLD
RPKAPFPVSQDATYTKALHQELTEVLADPASPVLPLLDLEAARAVVAREGGADLQDWLHR
MNVEMVLQVDAWLRELGGDVEL
selected fasta
>amide synthetase [asparagine synthetase]
ATGTGCGGCATCGCAGGCTGGGTGGTCCGCCAGGACGGAAGGCCCCGGGAGGACCCGGCG
GTGGCCGAGGCGATGGCCGGCGCCATGGCCTGCCGGGGCCCTGACGAGCAGGGTGTCCGC
GGCGGCCGGCACGTGACGCTGGTGCATACGCGGATGGCCGTCATCGACCTGCTCGGCGGG
CGCCAGCCGATGGCTGCGGACGAGAGCGAGGACCCGGCCGCCACGCTCACCTACTGCGGC
GAGATCTACAACGCCGCCGAACTACGCTCCGACCTGGCCGGACGGGGGCACCGGTTCCGC
ACCCGCAGTGATACCGAGGTGGTGCTGCGGGCGTATTTGGAGTGGGGCGAGCGCTGCCCC
GAGCGGCTGGAGGGGATGTTCGCCTTCGCCGTCTGGGACGCCCGCACGCGCTCCCTGTTC
CTCGCCCGCGACCGCTTCGGCGTCAAGCCGCTGTACTACGCCGAGACCGGCGACGGGCTG
GTCTTCGGGTCCGAGCCCAAGGCGCTGCTCGTCCACTCGGACGTGAGCCCCGAGGTCGAC
CTCGACGGGCTGCGCGTGCTGTTCTCCATGGCCCGAGCGCCCGGCGAGTGCGTCTACCGC
TCCCTCAGCGACCTGCCGCCCGCCCACACGCTGCGTTTCGGGCCCGACGGCCGGCTGTCG
CTGCGCCGGTACTGGCAGCTGGAGGCCCGGCCGCACGAGGAGGATCTGGCCGGGACGGTC
GCGACCGTGCGCGGGCTGCTGGAGAGCAGCGTCGCCCGGGAACTGGTCTCGGACGTCCCG
CTGAGCGTGCTGCTCTCGGGCGGCCTCGACTCCAGCACCGTGGCCGCGCTGGCGGCCAGG
GCCCTGGCGGACGGCGACGGCGGACCGGTGCGCACGACCACCGTGACGTACAGCGGTTAC
GGCGACAACTTCCAGCCCGACCTGGTGCGCAGCGCTCCCGACTCCCCGTACGCCCGTGCC
GTCGCCGAGCACATCGGTGCCGAGCACCTAGAGATCGAGCTGACCACCGCCGACCTGATC
GACCCGGTGGCCCGCCGCACCGTCCTGCGCGCCCAGGACGTCCCCGCCCCGTTCGGCGAC
ATGGACACCTCGACGTACCAGGCGTTCGCGGGCGTGCGCCGGCACTCCAGGGTGGCGCTG
ACCGGGGAGAGCGCCGACGAGATCTTCGGCGGCTACAGCTGGGTCCACATCCCCGACCTG
GCCCATGAGGAGCAATTCCCCTGGGTCGCCTTCGAGCAGTGGCATCCGGGTACGCGCCGG
GGGCTGGGCCAGGGGCTGCTCTCCCCGGCCTTCAAGGACCGGCTGGACATGGGCTCGTAC
TACGCCGAGCGGTACGCGCAGGCCATGTCCCGGATACCGCGGCTGCCGAGGGAGGGCGAG
GAGGAGCGCCGGGCCCGGGAGATCTGCGACCTGCACCTGACGCACTGGCTGCCACGGCTG
CTGGAGCGTAACGACCGGCTGAGCATGGTCTCGGGCCTGGAGGTCCGGGTGCCGTTCTGC
GACCACCGGCTGGTCCAGTACGCGTACAACATCCCCTGGGCGATGAAGACCTTCGACGGA
CGGGAGAAGAGCGTGCTGCGGGCCGCCGCCCGCGATCTGCTGCCCGAACGTGTGCTCGAC
CGGCCCAAGGCGCCCTTCCCGGTGAGCCAGGACGCGACGTACACCAAGGCCCTCCACCAG
GAACTCACCGAGGTGCTGGCCGACCCCGCCTCCCCGGTCCTGCCGCTGCTGGACCTGGAG
GCGGCGCGCGCCGTGGTCGCCCGGGAGGGGGGAGCTGACCTCCAGGACTGGCTGCACCGG
ATGAACGTGGAGATGGTGCTCCAGGTCGACGCCTGGCTCCGGGAGCTCGGGGGCGACGTC
GAGCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000583 Class II glutamine amidotransferase domain (Domain)
 [49-170]  1.2e-45 PF13537
PF13537   GATase_7
IPR001962 Asparagine synthase (Domain)
 [243-543]  9.39999999999981e-67 PF00733
PF00733   Asn_synthase
IPR006426 Asparagine synthase, glutamine-hydrolyzing (Family)
 [2-546]  TIGR01536
TIGR01536   Asn_synth_AEB
 [1-620]  1.09999184471405e-117 PIRSF001589
PIRSF001589   Asn_synthetase_glu-h
IPR014729 Rossmann-like alpha/beta/alpha sandwich fold (Domain)
 [226-396]  1.10000000000001e-73 G3DSA:3.40.50.620 [462-613]  1.10000000000001e-73 G3DSA:3.40.50.620
G3DSA:3.40.50.620   Rossmann-like_a/b/a_fold
IPR017932 Glutamine amidotransferase type 2 domain (Domain)
 [2-216]  PS51278
PS51278   GATASE_TYPE_2
SignalP
 [1-24]  0.078 Signal
Bacteria, Gram-positive   
TMHMM No significant hit