close all open/close all

CDS information : Fred_00260


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction24,236 / 22,401 / - [in whole cluster]
24,236 / 22,401 / - [in contig]
Locationcomplement(22401..24236) [in whole cluster]
complement(22401..24236) [in contig]
TypeCDS
Length1,836 bp (611 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Producttranscriptional activator
Product (GenBank)regulatory protein
GenefdmR1
Gene (GenBank)
EC number
Keyword
  • SARP family
Note
Note (GenBank)
  • FdmR1
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)
[18556785] Identification and utility of FdmR1 as a Streptomyces antibiotic regulatory protein activator for fredericamycin production in Streptomyces griseus ATCC 49344 and heterologous hosts. (J Bacteriol. , 2008)

close this sectionSequence

selected fasta
>transcriptional activator [regulatory protein]
MLQIGLLGTLQVVHEGVHVTPSAPKVRQVLALLALRANATVPLHQLVEELWEEHPPSSAA
TTLQTYIYQLRKLPGLCDQHRPGPAEDGGAALRTTPGGYRLAVSPDCMDAQRFGELAARG
RVFMEKGSTAEAADLMQRALAVWRGPALSDVAPGPVTGIDALRLEEQRYEVLEERLDADL
LLGRHHRLVSELTGLAADNPTREGLHAKLMLSLYRAGRRPEALEVFQRIRRVLARELGLE
PCAELQRLHQQVLAGDRGLDLPGGRTTVHAPRPGASPMTLPADSPLVGRDADLRHVGRVL
SAEEGAGGPQCVAVAGPPGAGTTAFTVHLAHRLGDSFPDGRLYASFGKGAAPLPVEEVLA
GLLEAVGHQRSELPPHRAGRARMFRNWTEGRRVLLVVDDVATTEQVADLLPAGSGSAALV
AGYRRLYGSQFKARVDLPPLGHERSLELFLDALGRGRGLDDPRGLHTMLDLCGDLPGPTL
EAVGVLALRPHWSVRQLMDWLGRGRLSAVAQQRPHPFHHVVGRCARLEPRLREALAKLAW
EAADDLTVEQAAAVLGKDGDETEEMLEELVELFLLGVGMASDPTTERFFQYRLAPLVRTA
LRAMQPAPSCV
selected fasta
>transcriptional activator [regulatory protein]
GTGCTGCAGATCGGGTTGCTTGGAACCCTGCAAGTCGTCCACGAAGGCGTACACGTCACA
CCGTCCGCACCGAAGGTCCGACAAGTTCTCGCGTTGCTCGCCCTGCGGGCCAACGCCACG
GTCCCGCTGCACCAGCTCGTCGAAGAGCTCTGGGAGGAACATCCGCCGTCCAGCGCCGCG
ACCACGCTCCAGACGTACATCTACCAGTTGCGCAAACTGCCCGGACTCTGCGACCAGCAC
CGTCCCGGGCCGGCCGAGGACGGTGGCGCCGCCCTGCGCACCACCCCCGGCGGCTATCGC
CTCGCCGTCTCCCCCGACTGCATGGACGCACAGCGGTTCGGCGAACTGGCCGCGAGAGGA
AGAGTCTTCATGGAGAAGGGGTCGACGGCGGAGGCCGCGGATCTGATGCAGCGGGCTCTC
GCCGTATGGCGGGGGCCCGCTCTCAGTGATGTGGCCCCCGGCCCCGTCACCGGGATCGAT
GCCCTGCGCCTGGAGGAACAGCGGTACGAGGTCCTGGAGGAGCGGCTCGACGCCGACCTG
CTGCTCGGCCGGCACCACCGCCTGGTCAGTGAATTAACGGGGCTCGCCGCGGACAACCCC
ACCCGAGAGGGGCTGCACGCGAAACTGATGCTCTCCCTCTACCGTGCCGGTCGTCGGCCG
GAGGCCCTGGAGGTCTTCCAGCGCATCCGCCGCGTCCTCGCCCGCGAGCTCGGGCTGGAG
CCGTGCGCGGAACTCCAGCGCCTGCACCAGCAGGTACTCGCCGGCGACCGCGGCCTCGAC
CTCCCGGGCGGCCGGACGACCGTGCACGCACCGCGCCCGGGTGCCTCGCCGATGACGCTG
CCCGCCGACTCGCCCCTGGTGGGCCGGGACGCCGATCTACGGCACGTGGGACGCGTCCTC
TCGGCGGAGGAGGGCGCGGGTGGCCCGCAGTGCGTCGCCGTGGCGGGGCCGCCCGGTGCG
GGCACCACCGCCTTCACCGTCCACCTCGCGCACCGCCTGGGCGACTCCTTCCCCGACGGG
CGCCTCTACGCCTCGTTCGGCAAGGGGGCCGCACCGCTGCCGGTCGAAGAGGTGCTGGCC
GGCCTCCTGGAGGCAGTGGGCCACCAGCGCTCCGAGCTGCCACCGCACCGCGCGGGCCGC
GCCCGGATGTTCCGGAACTGGACGGAGGGCCGCCGCGTGCTCCTGGTGGTGGACGACGTG
GCGACCACCGAGCAGGTCGCCGACCTGCTGCCGGCCGGCTCCGGGTCGGCCGCCCTGGTC
GCCGGGTACCGCAGGCTGTACGGCAGCCAGTTCAAGGCACGGGTGGATCTGCCGCCGCTG
GGCCACGAGAGGTCGCTGGAGCTCTTCCTCGACGCCCTGGGCCGCGGCCGCGGCCTGGAC
GACCCGCGCGGCCTGCACACCATGCTCGACCTCTGCGGCGACCTGCCCGGCCCCACCCTG
GAGGCCGTGGGGGTGCTGGCCCTGCGGCCGCACTGGTCGGTCCGCCAGCTCATGGACTGG
CTCGGCCGCGGCCGGCTCTCCGCCGTGGCCCAGCAGCGGCCGCATCCGTTCCACCACGTG
GTCGGGCGGTGCGCCCGGCTGGAGCCCCGGCTCCGGGAGGCGCTGGCGAAACTGGCCTGG
GAGGCGGCCGACGACCTCACGGTGGAACAGGCCGCCGCCGTCCTGGGGAAGGACGGGGAC
GAGACCGAGGAGATGCTCGAAGAACTGGTCGAGCTCTTCCTCCTCGGCGTCGGCATGGCG
AGCGACCCGACGACGGAACGGTTCTTCCAGTACCGCCTGGCCCCGCTGGTACGGACGGCG
CTGCGCGCCATGCAGCCGGCCCCCAGCTGCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [16-101]  1.29999924468179e-09 SM00862
SM00862   Trans_reg_C
 [20-73]  8.69999999999999e-13 PF00486
PF00486   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [108-253]  1.79999754022375e-47 SM01043
SM01043   BTAD
 [108-253]  5.10000000000004e-45 PF03704
PF03704   BTAD
IPR011990 Tetratricopeptide-like helical (Domain)
 [116-229]  1e-06 G3DSA:1.25.40.10 [525-540]  1e-06 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [24-102]  9.8e-07 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [1-102]  2.59999946718995e-12 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-39]  0.243 Signal
Bacteria, Gram-negative   
 [1-39]  0.379 Signal
Bacteria, Gram-positive   
 [1-39]  0.395 Signal
Eukaryota   
TMHMM No significant hit