close all open/close all

CDS information : Fred_00270


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction24,472 / 26,067 / + [in whole cluster]
24,472 / 26,067 / + [in contig]
Location24472..26067 [in whole cluster]
24472..26067 [in contig]
TypeCDS
Length1,596 bp (531 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)putative membrane transporter
GenefdmT2
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • FdmT2
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)
[18556785] Identification and utility of FdmR1 as a Streptomyces antibiotic regulatory protein activator for fredericamycin production in Streptomyces griseus ATCC 49344 and heterologous hosts. (J Bacteriol. , 2008)
Related Reference
ACC
Q9ZGB6
NITE
Lando_00240
PmId
[18537830] Coordination of export and glycosylation of landomycins in Streptomyces cyanogenus S136. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>putative drug resistance transporter [putative membrane transporter]
MPDAMPDRPRRPDADAPPPDGPLPPRFPLLLAALLLTSAMSMLDQSIVATAGPSLTGDLG
ALHLYSWTFTAYMLTFSVAMPVYGKLGDLFGRRPVYLAAIVIFLVGSLACGAAGSMGQLI
FFRALQGLGGGGLQVSAFAVLGDLMPPRRRAKYQGWFAGVMVIANLAGPLTGGLLTDQLG
WRWIFYVNLPVGLLAMAGIWALLPRSTRGAARPRVDVLGTALLTGLIVCLVLVTDLSGRY
GWAHPAVLGTGAGAVLLAAVWTRQSRRAAEPIVPLGLFANRTFTICVVVAFAVSFAFFGC
VNFVPLFFQTVEGVSATRTGLLFLPAMIGMAVATVVAGQVIGRTGRYKWFPVASTALAAL
AAGLMSLTSADTGAVAVSALLALMGVGVGLSSQVTTLVAQSSAPRRHIGVSTSTVGLARN
LGVAFGATVFGSLLNARLAVGSARLLPADVAERVVGGTLEPGRIGELGPRTASAVADVYS
EALSTVFLSAVPVLLIGLVLALMLKDVKLEARGQGGPGGQGAERPAAPRRG
selected fasta
>putative drug resistance transporter [putative membrane transporter]
GTGCCCGACGCCATGCCCGACCGCCCGCGACGTCCGGACGCCGACGCACCGCCCCCGGAC
GGCCCGCTGCCGCCCCGCTTCCCCCTCTTGCTCGCCGCGCTGCTCCTGACCAGTGCGATG
TCGATGCTCGACCAGTCGATCGTGGCCACCGCGGGCCCGAGCCTGACCGGCGACCTGGGC
GCGCTGCACCTCTACAGCTGGACGTTCACCGCGTACATGCTCACCTTCAGCGTGGCCATG
CCCGTCTACGGGAAACTCGGCGATCTCTTCGGCCGCCGGCCCGTCTATCTCGCGGCCATC
GTGATCTTCCTCGTGGGGTCCCTGGCGTGCGGGGCGGCCGGTTCCATGGGCCAGCTCATC
TTCTTCCGTGCCCTCCAGGGACTGGGCGGCGGCGGATTGCAGGTCAGCGCGTTCGCCGTG
CTCGGTGACCTGATGCCGCCCCGCCGGCGCGCGAAGTACCAGGGCTGGTTCGCGGGCGTG
ATGGTCATCGCCAACCTCGCGGGCCCGCTGACCGGCGGCCTCCTGACCGACCAGCTCGGC
TGGCGGTGGATCTTCTACGTCAACCTTCCTGTCGGTCTCCTCGCCATGGCGGGCATCTGG
GCCCTGCTGCCCCGGTCCACCCGGGGGGCCGCCAGGCCGCGGGTCGACGTGCTCGGTACG
GCCCTGCTCACAGGCCTCATCGTGTGCCTGGTCCTGGTCACCGACCTGTCCGGACGGTAC
GGCTGGGCCCACCCGGCGGTGCTCGGCACGGGCGCCGGCGCGGTCCTCCTCGCTGCGGTG
TGGACGCGTCAGTCGCGGCGTGCCGCCGAACCGATCGTCCCGCTCGGCCTCTTCGCGAAC
CGGACCTTCACCATCTGCGTGGTGGTGGCCTTCGCCGTCAGCTTCGCCTTCTTCGGCTGT
GTCAACTTCGTCCCGCTGTTCTTCCAGACGGTCGAGGGCGTCAGCGCCACCCGTACGGGA
CTGCTGTTCCTGCCCGCGATGATCGGTATGGCCGTGGCCACGGTCGTGGCGGGCCAGGTG
ATCGGCCGGACCGGGCGGTACAAGTGGTTCCCGGTGGCCAGTACGGCCCTCGCAGCGCTC
GCCGCCGGCCTCATGTCGCTCACCTCGGCCGACACGGGAGCGGTGGCCGTCAGCGCGCTG
CTGGCGTTGATGGGGGTCGGCGTCGGGCTCTCCTCGCAGGTGACGACGCTGGTCGCGCAG
AGTTCCGCGCCCCGGCGGCACATCGGCGTCAGCACCTCCACGGTCGGCCTCGCCCGCAAT
CTCGGGGTGGCCTTCGGCGCGACGGTCTTCGGCTCCCTGCTCAACGCCCGCCTGGCCGTC
GGGTCTGCGCGGCTCCTCCCCGCCGACGTGGCCGAGCGCGTGGTCGGCGGCACGCTGGAA
CCCGGAAGGATCGGCGAGCTCGGACCGCGGACGGCCTCAGCCGTGGCCGACGTCTACAGC
GAGGCGCTCTCCACCGTCTTCCTCTCAGCGGTACCCGTGCTGCTGATCGGGCTGGTCCTC
GCCCTGATGCTGAAAGACGTGAAGCTGGAGGCGCGCGGCCAGGGCGGACCCGGGGGCCAG
GGTGCCGAGCGGCCGGCCGCACCGCGGAGGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [34-427]  1e-56 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [5-504]  4.50001022902825e-82 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [30-509]  PS50850
PS50850   MFS
SignalP
 [1-41]  0.517 Signal
Eukaryota   
TMHMM
 [65-87]  Transmembrane (o-i) [94-116]  Transmembrane (i-o) [120-142]  Transmembrane (o-i) [155-177]  Transmembrane (i-o) [182-204]  Transmembrane (o-i) [217-236]  Transmembrane (i-o) [240-262]  Transmembrane (o-i) [283-305]  Transmembrane (i-o) [320-342]  Transmembrane (o-i) [349-368]  Transmembrane (i-o) [372-394]  Transmembrane (o-i) [415-434]  Transmembrane (i-o) [482-504]  Transmembrane (o-i)
Transmembrane 13