close all open/close all

CDS information : Fred_00280


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction26,150 / 26,629 / + [in whole cluster]
26,150 / 26,629 / + [in contig]
Location26150..26629 [in whole cluster]
26150..26629 [in contig]
TypeCDS
Length480 bp (159 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productholo-[acyl-carrier-protein] synthase
4'-phosphopantetheinyl transferase AcpS
Product (GenBank)holo-ACP synthase
GenefdmW
Gene (GenBank)
EC number2.7.8.7
Keyword
Note
Note (GenBank)
  • FdmW
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)
[16895912] A dedicated phosphopantetheinyl transferase for the fredericamycin polyketide synthase from Streptomyces griseus. (J Biol Chem. , 2006)

close this sectionSequence

selected fasta
>holo-[acyl-carrier-protein] synthase [holo-ACP synthase]
MQPDDEGAREWRRGPGGSGRFPWPLRLRARHPRPAPPRIVGVGIDVAAIARFGLALERSP
GLRDRLFTPEEQMLPSGSPRTTASLAARFAAKEAVAKVLGAPGGLRWHDVGVRTGARGRP
VLQVCGTVAAAAARQGISVWHLSLTHDGDVASAVVVGAA
selected fasta
>holo-[acyl-carrier-protein] synthase [holo-ACP synthase]
ATGCAACCTGACGACGAGGGCGCGAGGGAGTGGCGGCGCGGGCCCGGCGGGAGTGGCCGG
TTCCCCTGGCCGCTGCGGCTGAGGGCGCGTCACCCGAGACCGGCGCCGCCGCGGATCGTG
GGTGTGGGGATCGACGTGGCGGCGATAGCCAGGTTCGGGCTGGCCCTGGAGCGCAGCCCC
GGGCTGAGGGACCGCCTGTTCACTCCGGAGGAGCAGATGCTGCCTTCGGGGTCGCCCCGG
ACGACGGCTTCCCTGGCCGCGCGATTCGCCGCCAAGGAGGCCGTCGCCAAGGTGCTCGGT
GCGCCGGGCGGGCTCCGCTGGCACGACGTGGGGGTGCGGACCGGCGCCCGCGGCCGGCCC
GTCCTCCAGGTGTGCGGCACGGTCGCGGCCGCCGCCGCCCGGCAGGGGATCTCGGTCTGG
CACCTGTCGCTCACCCATGACGGTGACGTCGCCTCCGCCGTCGTCGTCGGTGCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004568 Phosphopantethiene-protein transferase (Domain)
 [39-157]  3.39999999999999e-20 TIGR00556
TIGR00556   Pantethn_trn
 [45-122]  PD004282
PD004282   PPantethiene-prot_Trfase
IPR008278 4'-phosphopantetheinyl transferase (Domain)
 [38-156]  3.69999438558106e-23 SSF56214
SSF56214   4-PPT_transf
 [39-156]  1e-35 G3DSA:3.90.470.20
G3DSA:3.90.470.20   G3DSA:3.90.470.20
 [41-155]  3.4e-15 PF01648
PF01648   ACPS
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM No significant hit