close all open/close all

CDS information : Fred_00290


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction26,869 / 27,381 / + [in whole cluster]
26,869 / 27,381 / + [in contig]
Location26869..27381 [in whole cluster]
26869..27381 [in contig]
TypeCDS
Length513 bp (170 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative MarR family transcriptional regulator
Product (GenBank)transcriptional regulator
GenefdmR2
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • FdmR2
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)
[18556785] Identification and utility of FdmR1 as a Streptomyces antibiotic regulatory protein activator for fredericamycin production in Streptomyces griseus ATCC 49344 and heterologous hosts. (J Bacteriol. , 2008)
Family/Domain
FD
IPR000835

close this sectionSequence

selected fasta
>putative MarR family transcriptional regulator [transcriptional regulator]
MERTTHTAGGDTAARKASPALPSGSLAQDLALVLPALHRALDRRVDADFPHPKPAEGQIA
LMRLIRDREGVTVREAAEVLLVKPNNLSATVTQMVAAGLVERRRDPDDKRVTHLHLTPTA
AERTHAVDELIGGYVEQALAGLSDGERGALGAAVGALHLLERGLHPSSAS
selected fasta
>putative MarR family transcriptional regulator [transcriptional regulator]
GTGGAGAGAACGACACATACGGCGGGCGGCGACACGGCAGCGCGGAAGGCGAGCCCTGCC
CTGCCCTCCGGCTCGCTCGCCCAGGACCTCGCCCTCGTCCTCCCCGCCCTCCACCGCGCC
CTGGACCGCCGCGTGGACGCCGACTTCCCGCACCCCAAGCCCGCCGAGGGCCAGATCGCC
CTGATGCGGCTGATCCGGGACCGGGAGGGCGTCACCGTCCGGGAGGCGGCCGAGGTGCTG
CTGGTCAAGCCCAACAACCTCAGCGCGACGGTGACCCAGATGGTGGCCGCGGGGCTGGTC
GAGCGCCGCCGGGACCCGGACGACAAGCGCGTCACCCACCTCCACCTCACCCCGACCGCA
GCCGAACGCACGCACGCCGTCGACGAGTTGATCGGCGGGTACGTCGAGCAGGCCCTGGCC
GGCCTCAGCGACGGCGAGCGGGGCGCACTCGGCGCCGCCGTCGGAGCCCTGCACCTGCTG
GAGCGCGGCCTCCACCCGTCGTCCGCCTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000835 Transcription regulator HTH, MarR-type (Family)
 [27-159]  PS50995
PS50995   HTH_MARR_2
 [47-147]  3.80000697093586e-17 SM00347
SM00347   HTH_MARR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [26-157]  1.9e-25 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR023187 Transcriptional regulator MarR-type, conserved site (Conserved_site)
 [86-120]  PS01117
PS01117   HTH_MARR_1
SignalP
 [1-40]  0.105 Signal
Bacteria, Gram-negative   
TMHMM No significant hit