close all open/close all

CDS information : Fred_00300


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction27,689 / 28,906 / + [in whole cluster]
27,689 / 28,906 / + [in contig]
Location27689..28906 [in whole cluster]
27689..28906 [in contig]
TypeCDS
Length1,218 bp (405 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative transposase
Product (GenBank)transposase
GenefdmX
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • FdmX
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)
Family/Domain
FD
IPR003346

close this sectionSequence

selected fasta
>putative transposase [transposase]
MFEIEDVGVFLGLDVGKTAHHGHGLTPAGKKIFDKPLPNSEPKLRAVFDKLTEKFGTVLV
IVDQPASIGALPLTVARDAGCRVAYLPGLAMRRIADLYPGEAKTDAKDAAVIADAARTMP
HTLRCLELTDEITAELTVLTGFDQDLAAEATRTSNRIRGLLTQFHPSLERVLGPRLDHQA
VTWLLERHGSPAALRKAGRRRLVELIRPKAPRMAQRLIDDVFDALDEQTVVVPGTGTLDT
VVPSLAASLASVHTQRRAMEAQINTLLEAHPLSPVLTSMPGVGVRTAAVLLVTVGDGTSF
PTAAHLASYAGLAPTTKSSGTSIHGEHAPRGGNRQLKRAMFLSAFACMNADPASRTYYDR
QRARGKTHTQALLRLARQRISVLFAMLRDGTFYEPRTPKNVELAA
selected fasta
>putative transposase [transposase]
ATGTTCGAGATCGAAGACGTGGGCGTGTTCCTCGGCCTGGACGTCGGCAAAACCGCTCAC
CACGGCCACGGACTCACCCCGGCCGGGAAGAAAATCTTCGACAAACCGCTACCCAACAGC
GAGCCGAAACTGCGGGCCGTCTTCGACAAGCTGACCGAGAAGTTCGGCACCGTCCTGGTC
ATCGTGGACCAGCCCGCCTCCATCGGCGCCCTCCCGCTGACCGTCGCCCGCGACGCCGGC
TGCCGCGTCGCCTACCTGCCCGGCCTGGCCATGCGCCGCATCGCCGACCTCTACCCCGGC
GAGGCCAAGACCGACGCCAAAGACGCCGCCGTCATCGCCGACGCCGCACGGACCATGCCG
CACACCCTGCGCTGCCTGGAACTCACCGACGAGATCACCGCCGAACTCACCGTGCTGACC
GGCTTCGACCAGGACCTCGCCGCCGAAGCCACCCGCACCTCCAACCGGATACGCGGCCTG
CTCACCCAGTTCCACCCCAGCCTCGAACGCGTCCTGGGCCCCCGCCTGGACCACCAGGCC
GTCACCTGGCTCCTGGAACGTCACGGCTCCCCGGCCGCCCTGCGCAAGGCTGGCCGCCGC
CGGCTCGTCGAACTGATCCGCCCCAAGGCCCCGCGCATGGCACAGCGCCTAATCGACGAC
GTCTTCGACGCCCTCGACGAGCAGACCGTCGTCGTCCCCGGCACCGGCACCCTCGACACC
GTCGTGCCCTCCCTGGCCGCTTCGCTGGCCTCCGTCCACACCCAGCGCCGTGCCATGGAA
GCCCAGATCAACACCCTGCTGGAGGCCCACCCTCTTTCCCCGGTCCTGACGTCGATGCCC
GGCGTCGGCGTCAGGACCGCCGCAGTCCTACTGGTCACCGTAGGCGACGGCACCAGCTTC
CCCACCGCCGCCCACCTCGCCTCCTACGCCGGCCTCGCCCCGACCACGAAGTCGTCCGGG
ACCTCGATCCACGGCGAACACGCACCCCGAGGCGGAAACCGGCAGCTCAAACGCGCCATG
TTCCTCTCCGCCTTCGCCTGCATGAACGCCGACCCCGCCTCCCGCACCTACTACGACCGC
CAGCGAGCCCGCGGCAAAACCCACACCCAAGCCCTCCTCCGCCTCGCTCGCCAACGCATC
AGCGTCCTGTTCGCCATGCTCCGCGACGGCACCTTCTACGAACCCCGGACACCGAAAAAC
GTCGAGCTCGCCGCATAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002525 Transposase, IS111A/IS1328/IS1533, N-terminal (Domain)
 [10-156]  1.6e-23 PF01548
PF01548   DEDD_Tnp_IS110
IPR003346 Transposase, IS116/IS110/IS902 (Family)
 [275-359]  1.1e-24 PF02371
PF02371   Transposase_20
SignalP No significant hit
TMHMM No significant hit