close all open/close all

CDS information : Fred_00310


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction28,988 / 30,565 / + [in whole cluster]
28,988 / 30,565 / + [in contig]
Location28988..30565 [in whole cluster]
28988..30565 [in contig]
TypeCDS
Length1,578 bp (525 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)putative membrane transporter
GenefdmT3
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • FdmT3
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)
Related Reference
ACC
P39886
PmId
[1592819] Sequence and transcriptional analysis of the Streptomyces glaucescens tcmAR tetracenomycin C resistance and repressor gene loci. (J Bacteriol. , 1992)
[1592820] The Streptomyces glaucescens TcmR protein represses transcription of the divergently oriented tcmR and tcmA genes by binding to an intergenic operator region. (J Bacteriol. , 1992)
ACC
O52557
NITE
Rifam_00370
PmId
[17351715] RifP; a membrane protein involved in rifamycin export in Amycolatopsis mediterranei. (Biotechnol Lett. , 2007)

close this sectionSequence

selected fasta
>putative drug resistance transporter [putative membrane transporter]
MSTRTPEAPPEPAPAPPSSTRRGNPWLTLIAVAFGLFMVALDGSVVSMANPEIGRDLNAG
TADLQWVTNSYLLALAAALILGGKLGDRFGRRTYYLIGVAGFTLASVAIGLAGSIEGVIA
FRAVQGFFGALLMPNTLGLLRAVFPPKKFGMAVGIWAMVSSVSTALGPIVGGLLVEHVNW
ESVFFINAPVGVLALAFSAWVLPQAKGEEGRGTRFDIPGVVLLALGLLLVVFAVVKGETW
GWASPATVLTLLAGLAVLVAFGLYENRVAHPLLPMRLFRNPALTVGTVITAVNFFVLLGV
IFFVMLYLQNVRGYSPVESGVRTLPLSLASVVAAPLGAALTGRFGARLTMPLGMLLQAGA
SLGILGWGLDTAYAVLWPPFVALGLGIGMVMAASSDAIVGNAPVRDAGVAGGLQSTALQV
GGALGTSVLISLISSRVSATFGPELASAGVPAPVADGLAEAKDAVAMGVAPVGPRLPESL
HGPVTEAAGQAFLNGVHAAAWVTACLCVAGAVASGWVLRRPTSGA
selected fasta
>putative drug resistance transporter [putative membrane transporter]
ATGTCCACCCGGACCCCCGAAGCCCCGCCCGAACCGGCACCCGCACCCCCGTCGTCCACC
CGGCGCGGCAACCCCTGGCTGACCCTCATAGCCGTCGCCTTCGGGCTCTTCATGGTGGCA
CTGGACGGCTCGGTCGTCTCCATGGCCAACCCGGAGATCGGCCGCGACCTGAACGCCGGC
ACCGCCGACCTCCAGTGGGTCACCAACTCCTACCTGCTGGCGCTCGCCGCCGCCCTCATC
CTCGGCGGCAAACTCGGCGACCGCTTCGGCCGCCGTACGTACTACCTGATCGGCGTCGCC
GGCTTCACCCTCGCCTCGGTCGCCATCGGGCTGGCCGGGTCGATCGAGGGCGTCATCGCC
TTCCGCGCCGTCCAGGGCTTCTTCGGCGCGCTGCTGATGCCGAACACGCTCGGGCTGCTG
CGCGCGGTCTTCCCGCCGAAGAAGTTCGGCATGGCGGTGGGCATCTGGGCGATGGTCTCC
TCGGTGTCGACGGCGCTGGGTCCGATCGTCGGCGGCCTGCTGGTCGAGCACGTCAACTGG
GAGTCCGTCTTCTTCATCAACGCCCCCGTGGGCGTCCTCGCCCTCGCCTTCAGCGCCTGG
GTGCTGCCGCAGGCCAAGGGCGAGGAGGGGCGCGGGACGCGGTTCGACATCCCCGGGGTG
GTGCTGCTCGCCCTCGGGCTGCTGCTCGTCGTCTTCGCCGTCGTCAAGGGCGAGACGTGG
GGCTGGGCCTCGCCGGCCACCGTGCTGACCCTGCTCGCCGGCCTCGCGGTCCTGGTCGCC
TTCGGCCTCTACGAGAACCGGGTCGCCCACCCGCTGCTGCCGATGCGCCTCTTCCGCAAC
CCGGCGCTGACCGTCGGCACCGTCATCACCGCCGTCAACTTCTTCGTCCTGCTCGGCGTG
ATCTTCTTCGTCATGCTGTACCTGCAGAACGTGCGCGGCTACAGCCCCGTCGAGTCCGGC
GTACGCACCCTCCCGCTCAGCCTCGCCTCGGTCGTCGCCGCCCCGCTCGGCGCCGCCCTC
ACCGGCCGCTTCGGCGCCCGCCTGACGATGCCGCTCGGCATGCTCCTCCAGGCCGGCGCC
TCCCTCGGCATCCTCGGCTGGGGCCTGGACACCGCCTACGCCGTGCTCTGGCCGCCCTTC
GTGGCGCTCGGCCTCGGCATCGGCATGGTCATGGCCGCCTCCTCGGACGCCATCGTGGGC
AACGCGCCCGTGCGGGACGCGGGGGTCGCGGGCGGCCTCCAGTCCACCGCCCTCCAGGTC
GGCGGCGCCCTGGGCACCTCCGTCCTCATCTCCCTGATCAGCAGCCGGGTCTCCGCGACC
TTCGGCCCCGAACTGGCCTCCGCCGGCGTCCCGGCCCCGGTCGCCGACGGCCTCGCCGAG
GCCAAGGACGCCGTCGCCATGGGCGTGGCCCCGGTAGGCCCCCGCCTCCCCGAATCCCTC
CACGGCCCCGTCACGGAGGCGGCCGGCCAGGCTTTCCTCAACGGCGTCCACGCCGCCGCC
TGGGTCACGGCCTGCCTGTGCGTGGCGGGGGCGGTGGCTTCGGGGTGGGTGCTGCGGCGG
CCGACGTCCGGCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004638 Drug resistance transporter EmrB/QacA subfamily (Family)
 [28-442]  9.10000000000013e-82 TIGR00711
TIGR00711   Efflux_EmrB
IPR011701 Major facilitator superfamily (Family)
 [33-426]  1.40000000000001e-55 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-203]  3.29999077503323e-52 SSF103473 [211-521]  3.0999994589937e-28 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [28-522]  PS50850
PS50850   MFS
SignalP
 [1-33]  0.425 Signal
Bacteria, Gram-positive   
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [27-49]  Transmembrane (i-o) [64-86]  Transmembrane (o-i) [93-115]  Transmembrane (i-o) [153-175]  Transmembrane (o-i) [180-202]  Transmembrane (i-o) [217-235]  Transmembrane (o-i) [242-264]  Transmembrane (i-o) [284-306]  Transmembrane (o-i) [319-341]  Transmembrane (i-o) [346-368]  Transmembrane (o-i) [373-395]  Transmembrane (i-o) [496-518]  Transmembrane (o-i)
Transmembrane 12