close all open/close all

CDS information : Fred_00320


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction31,229 / 30,621 / - [in whole cluster]
31,229 / 30,621 / - [in contig]
Locationcomplement(30621..31229) [in whole cluster]
complement(30621..31229) [in contig]
TypeCDS
Length609 bp (202 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in fredericamycins biosynthesis.
Note (GenBank)
  • Orf32
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MTTSTAPTEPGTPENLTARRVTDVLQPRNVLLGGMLGIGLAAAGGHWSGLLWGFLGALCA
GLIPAGYIEWQRGRGAWGDRHVVDRTKRAPIFFVILGSIGAGSLVMVAGNAPRDILVTML
ALWAMTIVLLAVNTVWKISVDAAVASAVVAQLAVVHHPAWLAAYALAGAVCWSRVALGYH
TVGQVCAGTAAGVATAAGFLVG
selected fasta
>hypothetical protein [unknown]
ATGACCACCAGCACCGCCCCCACCGAGCCCGGCACGCCGGAGAACCTCACCGCCCGCCGC
GTCACCGACGTCCTCCAGCCCCGCAACGTCCTCCTCGGCGGGATGCTCGGCATCGGCCTC
GCGGCGGCCGGCGGACACTGGTCCGGCCTCCTCTGGGGGTTCCTCGGGGCACTCTGCGCC
GGCCTCATACCCGCCGGATACATCGAATGGCAGCGCGGACGCGGCGCCTGGGGCGACCGC
CACGTGGTCGACCGCACCAAGCGCGCGCCGATCTTCTTCGTCATCCTCGGCTCCATCGGC
GCCGGTTCCCTGGTCATGGTGGCCGGGAACGCCCCCCGCGACATCCTCGTCACCATGCTG
GCCCTCTGGGCCATGACCATCGTCCTGCTCGCCGTCAACACCGTCTGGAAGATCTCCGTC
GACGCCGCCGTCGCCTCGGCCGTGGTGGCCCAGCTGGCCGTGGTGCACCATCCGGCGTGG
CTCGCCGCCTACGCGCTGGCGGGGGCGGTGTGCTGGTCGCGGGTGGCGCTGGGGTACCAC
ACGGTGGGGCAGGTGTGCGCGGGGACGGCGGCGGGGGTGGCTACTGCTGCGGGGTTCCTG
GTGGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [46-68]  Transmembrane (o-i) [89-111]  Transmembrane (i-o) [115-135]  Transmembrane (o-i) [142-164]  Transmembrane (i-o) [179-201]  Transmembrane (o-i)
Transmembrane 5