close all open/close all
Fred_00320 Fred_00320   last last

CDS information : Fred_00330


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction32,515 / 31,226 / - [in whole cluster]
32,515 / 31,226 / - [in contig]
Locationcomplement(31226..32515) [in whole cluster]
complement(31226..32515) [in contig]
TypeCDS
Length1,290 bp (429 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in fredericamycins biosynthesis.
Note (GenBank)
  • Orf33
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MSTLDLAGYLVAVLMTAVALWRMPAALWGDEEDRRRRALWGCYAGFAAALWTKTEFVRTT
LNDSPVTDLAVLIKHYTATIAILAILSYIVAIYGRYPDRGAVPRHVRFARLVQRVAAKAS
VATLILLTVLFFTVVDRSVPSDRFVSDHAGQPGATLYMTVFYVYLGAASAVCAYQWKLAT
ADATARHLRVGLSMMTAAMFIGVAYTASRTLFMWISVVDQPSVEFADTFDKVTEAGQVLL
FVLFAVGASLPAFSTGLRRARLWRAQARLHPLWRELMTAFPEQPFAPPASLLREVTRFDT
PADLRVDRWSADIADAVEKLRHYAPGHLADAARTAAAEDTADPDERGPRTDAHWIRAALV
AHAEGVPAGPAAPATDPRQAEDQEGEVAWLVRVAAACRTIPAARTTAVLAAARAGEAAAT
TNSPEQPTR
selected fasta
>hypothetical protein [unknown]
GTGAGTACCCTCGATCTGGCCGGTTACCTCGTCGCCGTGCTGATGACGGCCGTCGCCCTG
TGGCGGATGCCGGCGGCCCTCTGGGGGGACGAGGAGGACCGCCGCAGACGCGCCCTGTGG
GGCTGCTACGCCGGATTCGCCGCCGCCCTGTGGACCAAGACCGAGTTCGTCCGCACCACG
CTCAACGACAGCCCGGTCACCGACCTCGCCGTCCTCATCAAGCACTACACGGCGACCATC
GCGATCCTCGCCATCCTCAGCTACATCGTCGCCATCTACGGCCGCTACCCGGACCGGGGC
GCCGTCCCCCGCCACGTCCGCTTCGCCCGCCTCGTGCAGCGCGTCGCCGCCAAGGCGTCG
GTCGCCACCCTCATCCTGCTGACCGTCCTCTTCTTCACCGTCGTCGACCGCTCGGTCCCC
TCCGACCGCTTCGTCTCCGACCACGCGGGCCAGCCCGGCGCCACCCTCTACATGACGGTC
TTCTACGTCTACCTCGGCGCCGCCAGTGCCGTCTGCGCCTACCAGTGGAAGCTGGCCACC
GCCGACGCCACCGCCCGCCACCTGCGCGTCGGCCTGTCGATGATGACCGCCGCCATGTTC
ATCGGCGTCGCCTACACCGCCAGCCGCACCCTGTTCATGTGGATCAGCGTCGTCGACCAG
CCGAGCGTGGAGTTCGCCGACACCTTCGACAAGGTCACCGAGGCCGGACAGGTCCTGCTC
TTCGTCCTGTTCGCCGTCGGCGCCTCGCTGCCCGCCTTCTCCACCGGCCTGCGCCGCGCC
CGCCTCTGGCGCGCCCAGGCCCGGCTGCACCCGCTCTGGCGCGAGCTGATGACCGCCTTC
CCCGAGCAGCCCTTCGCCCCGCCCGCCTCCCTGCTGCGCGAGGTCACCCGCTTCGACACC
CCGGCCGACCTGCGCGTCGACCGCTGGTCCGCCGACATCGCCGACGCCGTCGAGAAGCTG
CGCCACTACGCGCCCGGGCACCTGGCCGACGCCGCCCGCACCGCCGCCGCCGAGGACACC
GCCGACCCCGACGAGCGGGGCCCGCGCACCGACGCCCACTGGATACGGGCCGCCCTCGTC
GCCCACGCCGAGGGCGTACCCGCCGGGCCCGCCGCCCCCGCCACCGACCCACGGCAGGCC
GAGGACCAGGAGGGCGAGGTCGCCTGGCTCGTCCGGGTCGCCGCCGCCTGCCGCACCATC
CCCGCCGCCCGCACCACCGCCGTCCTCGCCGCCGCCCGCGCGGGCGAGGCCGCCGCCACC
ACGAACTCCCCGGAGCAGCCGACCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-28]  0.364 Signal
Bacteria, Gram-positive   
 [1-29]  0.985 Signal
Eukaryota   
 [1-29]  0.541 Signal
Bacteria, Gram-negative   
TMHMM
 [7-29]  Transmembrane (i-o) [72-94]  Transmembrane (o-i) [115-134]  Transmembrane (i-o) [154-176]  Transmembrane (o-i) [188-207]  Transmembrane (i-o) [235-257]  Transmembrane (o-i)
Transmembrane 6   
Fred_00320 Fred_00320   last last