close all open/close all
first first   Fren_00020 Fren_00020

CDS information : Fren_00010


close this sectionLocation

Organism
StrainAK24158
Entry nameFrenolicin
Contig
Start / Stop / Direction1,563 / 3,875 / + [in whole cluster]
1,563 / 3,875 / + [in contig]
Location1563..3875 [in whole cluster]
1563..3875 [in contig]
TypeCDS
Length2,313 bp (770 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative transcriptional regulator/putative ABC transporter substrate-binding protein
Product (GenBank)FrnA
Gene
Gene (GenBank)frnA
EC number
Keyword
Note
  • bifunctional protein
Note (GenBank)
  • similar to Escherichia coli nikA
Reference
ACC
Related Reference
ACC
Q9AL82
PmId
[11133934] Identification of the nik gene cluster of Brucella suis: regulation and contribution to urease activity. (J Bacteriol. , 2001)
Family/Domain
FD
IPR004474
FD
IPR000914

close this sectionSequence

selected fasta
>putative transcriptional regulator/putative ABC transporter substrate-binding protein [FrnA]
MAGSGYAYYQHLSGNIDKIDVGDAGNKDAAPDGPINILIIGTDKRTGKGNEGCGGKDSPG
HADTNILLRVSADRTNTTGLSIPRDLITNIPDCLTTQDDGSKKTIPGTQNVRFNTSLGQE
GRDPGCTMRTVTELTGLKVDHFMMADFNAVKNLTTAVNGVEVCVAKDVDDPDSHLKLSAG
THKVQGEQALAFVRTRHSFGNQGDLDRIKVQQQFLGSLARQLKSEDTLTSPKKLYKVAEA
ATDALTVDSGIGSITKLMSLAKELQHINPKNITFVTLPVVDNPAEKVKATVVLNETDADP
QQSALGQSLDVGRQLVDSLTDQDPRDGKTVPWLATRWKADPEATRFTFTLRAGATFSDGT
PVDARAVKANFDAVHELGAAASRGAVYLDGYRETRVSGARTLTVVFDKPNAQFLRGTSTV
SLGLLSPGSLRRTPQERCTGRLVGSGPFVLDRYRPNTSVTLDRRKGYSWGSRLWQREGGA
YLEGVEYRIVPENTTRSGALSAGQLDVATALAPQDRERFSAPGWSLLTRTAPGVDLSLYV
NARRTALREAAVRQALQKGIDREAVATTFLSSRKLAATSVLSSTTPGYTDLGDRLAHDPA
GARRLLDKAGWRPGADGIRVKNGVRLRLDAVFVRQQSLELVQQQLKDIGVELRLRQLTVS
RFPEVLAAGSYDLSLQSANRADPDVLTTAFAGGTPVADARLRSELRRATSSTDEATRSSL
FAAAQRRLVDEGHVLPLNETEETAALSTRVHGLTRDASNRLVLHDTWTTG
selected fasta
>putative transcriptional regulator/putative ABC transporter substrate-binding protein [FrnA]
GTGGCCGGCAGCGGCTACGCGTACTACCAGCACCTCAGCGGCAACATCGACAAGATTGAC
GTCGGCGACGCGGGCAACAAGGACGCCGCCCCCGACGGGCCGATCAACATCCTGATCATC
GGCACCGACAAGCGCACCGGCAAGGGCAACGAGGGGTGCGGGGGCAAGGACAGCCCTGGC
CACGCGGACACCAACATCTTGCTGCGCGTCTCCGCCGACCGCACCAACACGACCGGCCTG
AGCATTCCGCGTGACCTCATCACGAACATCCCGGACTGCCTGACCACCCAGGACGACGGT
TCGAAGAAGACGATCCCCGGCACGCAGAACGTCCGCTTCAACACGAGCCTCGGGCAGGAG
GGCCGCGACCCCGGCTGCACGATGCGCACGGTCACCGAGCTGACCGGGCTCAAGGTCGAC
CACTTCATGATGGCCGACTTCAACGCGGTCAAGAACCTGACGACGGCCGTGAACGGCGTC
GAGGTGTGCGTGGCGAAGGACGTCGACGACCCCGACTCGCACCTCAAGCTCTCGGCGGGG
ACGCACAAGGTGCAGGGCGAGCAGGCGCTCGCCTTCGTCCGCACCCGGCACAGCTTCGGC
AACCAGGGCGACCTCGACCGCATCAAGGTCCAGCAGCAGTTCCTCGGTTCGCTCGCGCGG
CAGCTCAAGTCCGAGGACACGCTGACGAGTCCGAAGAAGCTCTACAAGGTCGCCGAGGCG
GCGACCGACGCGCTGACCGTGGACTCGGGGATCGGCAGCATCACGAAACTGATGTCGCTG
GCCAAGGAGTTGCAGCACATCAATCCGAAGAACATCACCTTCGTGACGCTCCCCGTGGTC
GACAACCCGGCCGAGAAGGTCAAGGCGACGGTCGTCCTCAATGAGACGGACGCTGATCCG
CAGCAGTCGGCTCTCGGGCAGAGTCTCGACGTGGGCCGCCAGCTCGTCGACTCGCTCACC
GACCAGGACCCGCGCGACGGCAAGACCGTCCCGTGGCTCGCGACGCGCTGGAAGGCCGAC
CCCGAGGCCACCCGCTTCACCTTCACCCTGCGCGCGGGCGCCACTTTCAGCGACGGCACA
CCGGTCGACGCGCGCGCGGTCAAGGCCAACTTCGACGCCGTGCACGAGCTCGGCGCCGCC
GCCTCGCGGGGGGCCGTGTACCTCGACGGCTACCGCGAGACGCGCGTCAGCGGCGCCCGT
ACGCTCACGGTCGTCTTCGACAAGCCGAACGCCCAGTTCCTGCGCGGCACGTCCACCGTC
TCACTGGGCCTGCTCTCGCCGGGCAGCCTGCGCCGCACCCCGCAGGAGCGCTGCACCGGG
CGCCTCGTCGGCTCCGGTCCCTTCGTGCTCGACCGCTACCGGCCGAACACCTCCGTCACG
CTGGACCGGAGAAAGGGCTACTCCTGGGGCTCGCGCCTGTGGCAACGGGAGGGCGGCGCG
TACCTGGAGGGGGTCGAGTACCGGATCGTGCCCGAGAACACGACCCGCTCGGGCGCCCTG
TCCGCCGGTCAGCTCGACGTCGCCACCGCGCTCGCGCCGCAGGACAGGGAGCGGTTCTCC
GCCCCCGGCTGGTCGCTGCTGACCCGTACCGCGCCCGGCGTCGACCTCAGCCTGTACGTC
AACGCGCGCCGCACGGCGCTGCGCGAGGCGGCGGTGCGCCAGGCCCTCCAGAAGGGCATC
GACCGCGAAGCCGTCGCCACGACCTTCCTCAGTTCCCGCAAGCTCGCGGCGACCAGCGTG
CTCTCCTCCACGACCCCCGGCTACACCGACCTCGGCGACCGCCTCGCCCACGACCCTGCG
GGTGCGAGGCGGCTGCTCGACAAGGCCGGATGGCGGCCCGGGGCGGACGGCATCAGGGTC
AAGAACGGCGTCAGGCTGCGACTCGACGCCGTCTTCGTCCGGCAGCAGAGCCTCGAACTC
GTGCAGCAGCAGCTCAAGGACATCGGCGTCGAACTGCGGCTGAGACAGCTCACCGTCTCC
CGTTTCCCCGAAGTGCTCGCCGCGGGCAGCTACGACCTGAGCCTCCAGAGCGCCAACCGC
GCCGATCCCGACGTCCTCACCACGGCCTTCGCGGGCGGCACCCCCGTCGCCGACGCGCGC
CTGCGCTCCGAACTGCGCCGGGCCACCTCCTCCACCGACGAGGCGACGCGCTCCTCGCTC
TTCGCCGCGGCGCAACGGCGTCTCGTCGACGAGGGGCACGTCCTGCCGCTCAACGAGACC
GAGGAGACCGCCGCGCTCTCGACGCGGGTGCACGGGCTGACGCGGGACGCCTCCAACCGG
CTGGTCCTGCACGACACCTGGACCACCGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000914 Bacterial extracellular solute-binding protein, family 5 (Domain)
 [329-700]  7.5e-64 PF00496
PF00496   SBP_bac_5
IPR004474 Cell envelope-related transcriptional attenuator (Domain)
 [61-223]  2.50000000000001e-36 TIGR00350
TIGR00350   LytR_cpsA_psr
 [61-224]  3.60000000000002e-43 PF03816
PF03816   LytR_cpsA_psr
SignalP No significant hit
TMHMM No significant hit
first first   Fren_00020 Fren_00020