close all open/close all

CDS information : Fren_00020


close this sectionLocation

Organism
StrainAK24158
Entry nameFrenolicin
Contig
Start / Stop / Direction3,872 / 4,843 / + [in whole cluster]
3,872 / 4,843 / + [in contig]
Location3872..4843 [in whole cluster]
3872..4843 [in contig]
TypeCDS
Length972 bp (323 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter permease protein
Product (GenBank)membrane protein of putative ABC transporter
Gene
Gene (GenBank)frnB
EC number
Keyword
Note
Note (GenBank)
  • FrnB; similar to Escherichia coli DPPB
Reference
ACC
Related Reference
ACC
O50262
PmId
[9987134] Mannopinic acid and agropinic acid catabolism region of the octopine-type Ti plasmid pTi15955. (Mol Microbiol. , 1999)
ACC
P0AEF8
PmId
[7536291] The dipeptide permease of Escherichia coli closely resembles other bacterial transport systems and shows growth-phase-dependent expression. (Mol Microbiol. , 1994)
[16905647] The housekeeping dipeptide permease is the Escherichia coli heme transporter and functions with two optional peptide binding proteins. (Proc Natl Acad Sci U S A. , 2006)

close this sectionSequence

selected fasta
>putative ABC transporter permease protein [membrane protein of putative ABC transporter]
MTARYLARRLGRVVLVVWAAYTLSFAVLYLLPGDPVQTMLSGAAGGDGAAVDPHEAQRLR
HTLGLDRPLAVQYTSMLGHALRGDLGTSIRSGAPVRGQLAQALPDTLSVALPALVLSVLV
ALCLALLGAWPRRRALRRAATALPSLGTAMPSFWLGLLLAQWVSFRWGLLPATGGGRSPR
ATLLAALTLALPIGCVLAQVLGRGLRAALAEPYADVARSRGAGRARLLLARALRNASVAA
LALLGVVCGQLLAGAVLVETVFARGGIGRLAMDAVTYQDLPVVQGVVVLAALVAALVNLV
VDLLLPLLEPRTASEAADAVPAH
selected fasta
>putative ABC transporter permease protein [membrane protein of putative ABC transporter]
GTGACGGCCCGCTACCTGGCCCGCCGGCTGGGCCGCGTCGTCCTCGTCGTCTGGGCCGCG
TACACCCTGTCCTTCGCCGTCCTCTACCTGCTGCCGGGAGATCCCGTGCAGACCATGCTG
AGCGGCGCGGCGGGCGGGGACGGGGCGGCCGTCGACCCGCACGAGGCCCAGCGGCTGCGC
CACACGCTCGGCCTCGACCGCCCGCTCGCCGTCCAGTACACCAGCATGCTGGGGCACGCC
CTGCGCGGAGACCTCGGCACCTCGATCCGCAGCGGGGCGCCCGTACGCGGGCAACTCGCC
CAAGCGCTGCCCGACACCCTCTCGGTGGCCCTCCCCGCGCTCGTCCTCAGCGTGCTCGTC
GCGCTCTGCCTCGCCCTCCTCGGGGCCTGGCCCCGGCGACGAGCCCTGCGCAGGGCGGCG
ACCGCCCTGCCCTCGCTCGGCACCGCGATGCCCAGCTTCTGGCTGGGGCTGCTCCTCGCC
CAGTGGGTCTCCTTCCGCTGGGGACTGCTCCCCGCCACGGGCGGCGGGCGCTCGCCCCGG
GCCACCCTGCTGGCCGCGCTGACCCTCGCCCTGCCCATCGGCTGCGTGCTCGCCCAGGTG
CTGGGGAGGGGCCTGCGCGCCGCGCTCGCCGAGCCGTACGCGGACGTGGCGCGCTCGCGC
GGCGCGGGGCGGGCCAGGCTGCTGCTCGCGCGCGCGCTGCGCAACGCCTCGGTGGCCGCC
CTGGCCCTGCTCGGCGTCGTGTGCGGGCAACTCCTCGCCGGGGCCGTCCTGGTGGAGACC
GTCTTCGCCAGGGGCGGCATCGGGCGCCTCGCCATGGACGCCGTCACCTACCAGGACCTG
CCCGTCGTGCAGGGCGTGGTGGTGCTCGCCGCCCTCGTCGCGGCGCTGGTCAACCTCGTG
GTGGACCTCCTCCTCCCGCTCCTCGAGCCGCGTACCGCCTCGGAGGCCGCCGATGCCGTC
CCTGCCCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000515 Binding-protein-dependent transport systems inner membrane component (Family)
 [124-312]  4.70000000000001e-20 PF00528
PF00528   BPD_transp_1
 [103-305]  PS50928
PS50928   ABC_TM1
SignalP
 [1-19]  0.562 Signal
Bacteria, Gram-negative   
 [1-43]  0.956 Signal
Bacteria, Gram-positive   
 [1-26]  0.674 Signal
Eukaryota   
TMHMM
 [13-32]  Transmembrane (i-o) [108-130]  Transmembrane (o-i) [143-165]  Transmembrane (i-o) [180-202]  Transmembrane (o-i) [236-258]  Transmembrane (i-o) [286-308]  Transmembrane (o-i)
Transmembrane 6