close all open/close all

CDS information : Fren_00030


close this sectionLocation

Organism
StrainAK24158
Entry nameFrenolicin
Contig
Start / Stop / Direction4,947 / 5,771 / + [in whole cluster]
4,947 / 5,771 / + [in contig]
Location4947..5771 [in whole cluster]
4947..5771 [in contig]
TypeCDS
Length825 bp (274 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter permease protein
Product (GenBank)membrane component of putative ABC transporter
Gene
Gene (GenBank)frnC
EC number
Keyword
Note
Note (GenBank)
  • FrnC; similar to Escherichia coli DPPC
Reference
ACC
Related Reference
ACC
P77463
PmId
[7536291] The dipeptide permease of Escherichia coli closely resembles other bacterial transport systems and shows growth-phase-dependent expression. (Mol Microbiol. , 1994)
[16905647] The housekeeping dipeptide permease is the Escherichia coli heme transporter and functions with two optional peptide binding proteins. (Proc Natl Acad Sci U S A. , 2006)
ACC
O50261
PmId
[9987134] Mannopinic acid and agropinic acid catabolism region of the octopine-type Ti plasmid pTi15955. (Mol Microbiol. , 1999)

close this sectionSequence

selected fasta
>putative ABC transporter permease protein [membrane component of putative ABC transporter]
MALRRVAALWRAPGLALSLLVLLLVLGWALLPGLFTAADPLRADAAHRLLAPGAGHPLGA
DHVGRDLYARVVHGTARSLGTAFAAVALGVLAGGALGAVAGVAGRAVDAVVMRVVDVLLA
VPGLLLSLAVVSALGFGTAQVACAVGVGTVGGIARVSRAQVRRVRGGEYVEAARLAGVAG
PLILLRHIVPNAAPPVLALAVTECGTAVLGVASLGFLGFGAPPPAPEWGALISTGRDYLV
SAWWLTTLPGLVLVALVVALHRVGRALEREERTG
selected fasta
>putative ABC transporter permease protein [membrane component of putative ABC transporter]
GTGGCGCTCCGGCGCGTCGCCGCGCTGTGGCGGGCGCCCGGACTGGCCCTGTCCCTGCTC
GTCCTCCTGCTCGTCCTCGGCTGGGCGCTGCTGCCCGGCCTGTTCACGGCGGCCGACCCT
CTGCGGGCCGACGCCGCGCACCGCCTGCTCGCCCCCGGCGCCGGACACCCGCTCGGCGCC
GATCACGTCGGCCGCGACCTCTACGCGCGGGTCGTGCACGGCACCGCGCGCTCGCTGGGC
ACGGCGTTCGCCGCCGTCGCGCTCGGGGTGCTCGCCGGCGGTGCGCTCGGGGCCGTGGCC
GGAGTGGCGGGGCGCGCGGTGGACGCCGTCGTCATGCGCGTCGTGGACGTCCTCCTGGCC
GTCCCCGGGCTGCTGCTCTCGCTCGCGGTGGTCTCCGCGCTCGGCTTCGGCACCGCGCAG
GTCGCCTGCGCGGTCGGCGTGGGCACCGTCGGCGGGATCGCCAGGGTGAGCCGTGCGCAG
GTGCGGCGCGTGCGCGGCGGCGAGTACGTCGAGGCCGCGCGCCTCGCCGGGGTCGCGGGG
CCGCTGATCCTGCTGCGCCACATCGTGCCCAACGCGGCTCCGCCCGTGCTCGCGCTCGCC
GTCACCGAGTGCGGCACCGCGGTACTCGGCGTCGCGTCCCTCGGCTTCCTCGGCTTCGGC
GCGCCGCCGCCCGCCCCGGAGTGGGGCGCCCTCATCTCCACCGGCCGGGACTACCTCGTC
TCCGCCTGGTGGCTCACCACCCTGCCGGGCCTCGTGCTCGTCGCCCTCGTCGTCGCCCTG
CACCGCGTCGGCCGCGCCCTGGAACGAGAGGAACGCACCGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000515 Binding-protein-dependent transport systems inner membrane component (Family)
 [75-264]  PS50928
PS50928   ABC_TM1
 [94-269]  3.3e-22 PF00528
PF00528   BPD_transp_1
SignalP
 [1-38]  0.985 Signal
Bacteria, Gram-negative   
 [1-29]  0.997 Signal
Eukaryota   
 [1-45]  1 Signal
Bacteria, Gram-positive   
TMHMM
 [13-35]  Transmembrane (i-o) [80-102]  Transmembrane (o-i) [109-131]  Transmembrane (i-o) [135-157]  Transmembrane (o-i) [196-218]  Transmembrane (i-o) [238-260]  Transmembrane (o-i)
Transmembrane 6