close all open/close all

CDS information : Fren_00040


close this sectionLocation

Organism
StrainAK24158
Entry nameFrenolicin
Contig
Start / Stop / Direction5,768 / 7,342 / + [in whole cluster]
5,768 / 7,342 / + [in contig]
Location5768..7342 [in whole cluster]
5768..7342 [in contig]
TypeCDS
Length1,575 bp (524 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter ATP-binding protein
Product (GenBank)ATPase component of putative ABC transporter
Gene
Gene (GenBank)frnD
EC number
Keyword
Note
Note (GenBank)
  • FrnD; similar to Streptomyces peucetius DRRA
Reference
ACC
Related Reference
ACC
P0AAG0
PmId
[7536291] The dipeptide permease of Escherichia coli closely resembles other bacterial transport systems and shows growth-phase-dependent expression. (Mol Microbiol. , 1994)
[16905647] The housekeeping dipeptide permease is the Escherichia coli heme transporter and functions with two optional peptide binding proteins. (Proc Natl Acad Sci U S A. , 2006)
ACC
P37313
PmId
[7536291] The dipeptide permease of Escherichia coli closely resembles other bacterial transport systems and shows growth-phase-dependent expression. (Mol Microbiol. , 1994)
[16905647] The housekeeping dipeptide permease is the Escherichia coli heme transporter and functions with two optional peptide binding proteins. (Proc Natl Acad Sci U S A. , 2006)
ACC
O50263
PmId
[9987134] Mannopinic acid and agropinic acid catabolism region of the octopine-type Ti plasmid pTi15955. (Mol Microbiol. , 1999)

close this sectionSequence

selected fasta
>putative ABC transporter ATP-binding protein [ATPase component of putative ABC transporter]
MTPADKPTDERSPVLDLSGVSVAYGTRTVLHGIDLRLAPGQVLAVLGASGSGKSTLAQAA
LGLLPPGGRVTAGRVTVAGHDITALAPHRLRALRGTVTGLVPQDQAVSLDPLVRVGAQVT
ETLRAHRLEDRREAARRAVPLLGEAGIEAPGPLARAYPHALSGGQRQRVLVAGAFAARPP
LVVADEPTSALDATVRRRVMDRFAALVAAHGTAVLLVTHDFRLARERADQVAVLADGRLV
ESGPAARVLDRPAHPYTRRLTGAGRRVAARGTAPRASGTPVVRARDLVKEYRRDGRRVRA
VDGVGFTVREGEFFALVGESGSGKSTTARLVTGLTAPTSGAVEHAPAPVRPQLVQQSPYA
AFDPRWTVRRIVEEPLRARHVPGARRRARLRELLALVGLDEELLARRPRELSGGQRQRVA
LARALAPEPRLLVCGEPVAALDPVARERVVHLLERLRAELGLTCLFVSHELDVVRRLCGR
VAVMRGGRLLESGPVGEVLSAPSQPYTRALLAAEAGPSDTPGAG
selected fasta
>putative ABC transporter ATP-binding protein [ATPase component of putative ABC transporter]
ATGACCCCGGCGGACAAGCCGACCGACGAGCGCTCACCTGTCCTGGACCTCAGTGGTGTC
AGCGTCGCCTACGGGACGCGCACCGTGCTGCACGGCATCGATCTGCGCCTCGCGCCGGGG
CAGGTGCTCGCGGTGCTCGGCGCCTCGGGTTCCGGCAAGAGCACCCTCGCGCAGGCGGCT
CTCGGCCTCCTGCCCCCCGGCGGCCGGGTGACGGCAGGGCGCGTCACGGTCGCCGGGCAC
GACATCACCGCGCTCGCGCCGCACCGGCTGCGCGCGCTGCGCGGCACGGTCACCGGACTC
GTGCCGCAGGACCAGGCGGTCTCCCTCGACCCCCTCGTCCGCGTCGGCGCGCAGGTCACC
GAGACGCTGCGCGCCCATCGCCTGGAGGACCGCCGCGAGGCCGCCCGGCGCGCCGTGCCC
TTGCTCGGCGAGGCGGGGATCGAGGCCCCCGGGCCGCTCGCCCGCGCCTACCCGCACGCG
CTCTCCGGCGGCCAACGCCAACGCGTCCTCGTCGCCGGGGCCTTCGCGGCCCGCCCCCCG
CTGGTCGTCGCCGACGAGCCGACGAGCGCGCTCGACGCGACCGTGCGGCGCCGGGTCATG
GACCGCTTCGCCGCCCTCGTCGCCGCGCACGGCACGGCCGTCCTCCTCGTCACCCACGAC
TTCCGGCTCGCGAGGGAACGCGCCGACCAGGTCGCCGTCCTCGCGGACGGCCGTCTCGTG
GAGAGCGGCCCCGCCGCACGGGTCCTCGACCGGCCCGCCCACCCGTACACCCGCCGCCTC
ACGGGGGCCGGCCGCCGCGTGGCCGCACGGGGCACGGCGCCGCGCGCGTCGGGCACCCCC
GTGGTGCGCGCCCGCGACCTCGTCAAGGAGTACCGGCGGGACGGGCGGCGGGTGCGCGCC
GTGGACGGGGTCGGCTTCACGGTCCGCGAAGGCGAGTTCTTCGCCCTCGTCGGCGAGTCG
GGCTCGGGCAAGTCCACGACCGCCCGGCTCGTGACGGGTCTGACCGCGCCCACGTCGGGC
GCGGTGGAGCACGCGCCCGCTCCGGTGCGGCCCCAGCTCGTCCAGCAGAGCCCGTACGCG
GCCTTCGACCCGCGCTGGACCGTGCGCCGCATCGTGGAGGAGCCGCTGCGGGCGCGGCAC
GTGCCCGGGGCGCGGCGGCGGGCGCGGCTGCGCGAACTGCTCGCGCTCGTCGGCCTCGAC
GAGGAGCTGCTCGCGCGGCGGCCCCGGGAGCTGTCCGGCGGGCAGCGGCAGCGGGTGGCG
CTCGCCCGCGCGCTCGCCCCGGAACCGCGCCTGCTCGTGTGCGGCGAACCCGTCGCCGCC
CTCGACCCCGTCGCGCGCGAGCGCGTCGTCCACCTCCTGGAGCGGCTGCGGGCGGAGCTG
GGCCTCACGTGCCTCTTCGTCTCCCACGAGCTGGACGTCGTGCGGCGGTTGTGCGGTCGC
GTCGCCGTCATGCGGGGCGGGCGGCTACTGGAGAGCGGACCGGTGGGGGAGGTGCTGTCG
GCGCCCTCGCAGCCGTACACGCGGGCGCTGCTCGCCGCGGAGGCGGGCCCTTCCGACACG
CCCGGAGCGGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [15-261]  PS50893 [282-511]  PS50893
PS50893   ABC_TRANSPORTER_2
 [54-189]  5.59999999999999e-13 PF00005 [325-438]  6.80000000000001e-16 PF00005
PF00005   ABC_tran
IPR003593 AAA+ ATPase domain (Domain)
 [39-238]  1.50000306971104e-18 SM00382 [310-488]  2.39999798157265e-15 SM00382
SM00382   AAA
IPR013563 Oligopeptide/dipeptide ABC transporter, C-terminal (Domain)
 [240-269]  3.7e-05 PF08352 [490-514]  0.0075 PF08352
PF08352   oligo_HPY
IPR017871 ABC transporter, conserved site (Conserved_site)
 [161-175]  PS00211 [411-425]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP
 [1-32]  0.163 Signal
Bacteria, Gram-negative   
TMHMM No significant hit