close all open/close all

CDS information : Fren_00050


close this sectionLocation

Organism
StrainAK24158
Entry nameFrenolicin
Contig
Start / Stop / Direction7,460 / 8,110 / + [in whole cluster]
7,460 / 8,110 / + [in contig]
Location7460..8110 [in whole cluster]
7460..8110 [in contig]
TypeCDS
Length651 bp (216 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)FrnE
Gene
Gene (GenBank)frnE
EC number
Keyword
Note
Note (GenBank)
Reference
ACC

close this sectionSequence

selected fasta
>hypothetical protein [FrnE]
MNEITVEIWTDVVCPWCYIGKRRFERALAAFDAKEDVRVHWRSFELDPAALRVTDETIPE
RMLRRQGIPPEQAAELLAGVSAQAEAEGLEYHLDRARPCNTFDAHRLAHHAGTRGLAETF
QERLMCAYTAEGVSVGDHPTLLALAEEAGLDAAAAAEVLAGDAHAEDVRADEDRAARLGV
GGVPAFVIGGRWSVSGAQPAELLTGLLERARTAAAA
selected fasta
>hypothetical protein [FrnE]
GTGAACGAGATCACTGTCGAGATCTGGACCGACGTCGTCTGCCCGTGGTGCTACATCGGC
AAGCGGCGCTTCGAGCGGGCGCTGGCCGCCTTCGACGCGAAGGAGGACGTGCGCGTCCAC
TGGCGCAGCTTCGAACTCGACCCCGCCGCCCTGCGGGTCACCGACGAGACCATCCCCGAG
CGCATGCTGCGCCGCCAGGGCATCCCGCCCGAGCAGGCCGCCGAACTCCTCGCCGGGGTG
AGCGCCCAGGCCGAGGCCGAAGGGCTGGAGTACCACCTCGACCGCGCCCGGCCCTGCAAC
ACCTTCGACGCGCACCGGCTCGCCCACCACGCGGGCACGCGGGGCCTCGCGGAGACCTTC
CAGGAACGGCTGATGTGCGCCTACACCGCCGAGGGCGTCTCGGTGGGCGACCACCCCACC
CTGCTGGCCCTCGCCGAGGAGGCGGGGCTCGACGCGGCCGCCGCCGCCGAGGTGCTGGCC
GGTGACGCGCACGCCGAGGACGTACGGGCCGACGAGGACCGGGCCGCCCGGCTCGGCGTC
GGAGGGGTGCCCGCCTTCGTGATCGGCGGACGCTGGTCCGTCTCGGGCGCCCAGCCCGCC
GAACTCCTCACCGGTCTCCTGGAACGGGCCCGGACCGCAGCCGCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001853 DSBA-like thioredoxin domain (Domain)
 [5-207]  3.40000000000004e-46 PF01323
PF01323   DSBA
IPR012336 Thioredoxin-like fold (Domain)
 [3-47]  3.3e-22 G3DSA:3.40.30.10 [99-206]  3.3e-22 G3DSA:3.40.30.10
G3DSA:3.40.30.10   Thioredoxin_fold
 [4-211]  3.10001307370206e-44 SSF52833
SSF52833   Thiordxn-like_fd
SignalP
 [1-29]  0.271 Signal
Bacteria, Gram-positive   
TMHMM No significant hit