close all open/close all

CDS information : Fren_00080


close this sectionLocation

Organism
StrainAK24158
Entry nameFrenolicin
Contig
Start / Stop / Direction11,548 / 11,033 / - [in whole cluster]
11,548 / 11,033 / - [in contig]
Locationcomplement(11033..11548) [in whole cluster]
complement(11033..11548) [in contig]
TypeCDS
Length516 bp (171 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative NADH-dependent FMN reductase
Product (GenBank)actVB homolog
Gene
Gene (GenBank)frnH
EC number1.5.1.42
Keyword
  • two-component system
  • C-6 quinone formation
Note
Note (GenBank)
  • FrnH
Reference
ACC
Related Reference
ACC
Q02058
NITE
Actino_00230
PmId
[7615536] Identification of a flavin:NADH oxidoreductase involved in the biosynthesis of actinorhodin. Purification and characterization of the recombinant enzyme. (J Biol Chem. , 1995)
[18245777] Mechanism and regulation of the Two-component FMN-dependent monooxygenase ActVA-ActVB from Streptomyces coelicolor. (J Biol Chem. , 2008)
[19246012] Biosynthesis of actinorhodin and related antibiotics: discovery of alternative routes for quinone formation encoded in the act gene cluster. (Chem Biol. , 2009)
[22086671] Epoxyquinone formation catalyzed by a two-component flavin-dependent monooxygenase involved in biosynthesis of the antibiotic actinorhodin. (Chembiochem. , 2011)

close this sectionSequence

selected fasta
>putative NADH-dependent FMN reductase [actVB homolog]
MNETRTAARTGQVGPVDAEGFRAAMSCFPAGVVLVTTREEDGTPRGFTASSFCSVSLAPP
LVSVCQGTGAQSYGAFQECARFAVSVLRSGQRELASRFATRGADKFGGGGLVALEGSGLL
VAADALVTLECAVHARHLAGDHVILVGEVRGVGQGEGEPLVHWERGFRALR
selected fasta
>putative NADH-dependent FMN reductase [actVB homolog]
GTGAACGAGACACGGACGGCCGCGCGGACGGGGCAGGTCGGGCCGGTCGATGCCGAGGGC
TTCCGCGCCGCGATGTCGTGCTTCCCCGCGGGGGTGGTCCTCGTGACGACGCGCGAGGAG
GACGGCACCCCCCGCGGTTTCACGGCGAGTTCCTTCTGCTCGGTGTCGCTCGCTCCCCCG
CTGGTGTCGGTGTGCCAGGGCACGGGCGCGCAGTCCTACGGGGCGTTCCAGGAGTGCGCG
CGGTTCGCGGTGAGCGTGCTGCGGAGCGGACAGCGGGAGCTGGCCTCGCGGTTCGCGACG
CGCGGGGCGGACAAGTTCGGGGGCGGGGGGCTCGTGGCGCTGGAGGGCTCGGGGCTGCTG
GTCGCGGCGGACGCGCTCGTCACGCTGGAGTGCGCGGTACACGCCCGGCACCTGGCCGGG
GACCACGTGATCCTCGTCGGCGAGGTGCGCGGGGTGGGGCAGGGTGAGGGCGAACCGCTC
GTGCACTGGGAGCGGGGGTTTCGCGCGCTGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002563 Flavin reductase-like, FMN-binding (Domain)
 [25-169]  1.10000150671643e-51 SM00903
SM00903   Flavin_Reduct
 [25-170]  9.69999999999989e-34 PF01613
PF01613   Flavin_Reduct
IPR009002 FMN-binding split barrel-related (Domain)
 [13-170]  1.40000506907309e-48 SSF50475
SSF50475   FMN_binding
IPR012349 FMN-binding split barrel (Domain)
 [16-170]  1.2e-52 G3DSA:2.30.110.10
G3DSA:2.30.110.10   PNPOx_FMN_bd
SignalP
 [1-34]  0.065 Signal
Eukaryota   
TMHMM No significant hit