close all open/close all

CDS information : Fren_00090


close this sectionLocation

Organism
StrainAK24158
Entry nameFrenolicin
Contig
Start / Stop / Direction12,555 / 11,545 / - [in whole cluster]
12,555 / 11,545 / - [in contig]
Locationcomplement(11545..12555) [in whole cluster]
complement(11545..12555) [in contig]
TypeCDS
Length1,011 bp (336 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productbeta-ketoacyl synthase
Product (GenBank)putative four carbon starter unit synthase
GenefrnI
frenI
Gene (GenBank)frnI
EC number
Keyword
Note
Note (GenBank)
  • FrnI; FABH (KAS III) homolog
Reference
ACC
PmId
[12767243] Ketosynthases in the initiation and elongation modules of aromatic polyketide synthases have orthogonal acyl carrier protein specificity. (Biochemistry. , 2003)
Related Reference
ACC
Q9F6D4
NITE
R1128_00080
PmId
[11732905] In vitro reconstitution and analysis of the chain initiating enzymes of the R1128 polyketide synthase. (Biochemistry. , 2001)
[12767243] Ketosynthases in the initiation and elongation modules of aromatic polyketide synthases have orthogonal acyl carrier protein specificity. (Biochemistry. , 2003)
[19292437] Biosynthesis of aromatic polyketides in bacteria. (Acc Chem Res. , 2009)

close this sectionPKS/NRPS Module

KS14..335

close this sectionSequence

selected fasta
>beta-ketoacyl synthase [putative four carbon starter unit synthase]
MTGEAEMLGTRPVVHSRLLGVGGYRPRRSVDNAELCATVASTPEWIETRSGIRARGFAAP
DETLRFMGRAAAEKALARAGVLPDGIDLVLVASMSRLEQTPPLAVLLAEDLGARAAAGLD
VSGACAGFCHALALASDAVRAGSARHVLVVGTERMTDLVERADRTVSVLFADGAGAAVVG
PSARPGISPPARGAAGRYAGALRMDRGWDTFAADPSLGRPWMRMDGRRVFRWAMDEVTPR
AAELLRESGIEPEALDAFVPHQANLRMIELMAERLGLPERTAVARDVVRAGNTSAASVPL
ALEALLDSGEVGSGDRALLVGFGAGLNYAAQVVELP
selected fasta
>beta-ketoacyl synthase [putative four carbon starter unit synthase]
GTGACCGGCGAGGCGGAGATGCTCGGTACGCGGCCTGTCGTGCACAGCAGGCTCTTGGGG
GTGGGGGGTTACCGGCCCCGGCGCAGTGTGGACAACGCCGAACTGTGTGCCACGGTCGCG
TCGACCCCGGAGTGGATAGAGACCCGCAGCGGTATCCGTGCGCGCGGCTTCGCCGCGCCG
GACGAGACCTTGCGGTTCATGGGGCGGGCGGCGGCCGAGAAGGCGCTCGCGCGGGCGGGG
GTGCTGCCGGACGGGATCGATCTGGTGCTGGTGGCGAGCATGTCGCGGCTGGAGCAGACG
CCCCCGCTCGCCGTGCTCCTCGCCGAGGACCTCGGCGCGCGGGCGGCGGCGGGGCTGGAC
GTGTCCGGCGCCTGCGCCGGTTTCTGCCACGCGCTGGCGCTCGCTTCGGACGCGGTGCGC
GCCGGGAGCGCCCGGCACGTCCTGGTGGTGGGCACGGAGCGGATGACGGATCTCGTGGAG
CGTGCGGACCGCACCGTCTCCGTGCTCTTCGCGGACGGGGCGGGAGCCGCTGTGGTGGGG
CCTTCGGCGCGGCCGGGGATCTCGCCGCCGGCGCGTGGTGCGGCGGGCCGGTACGCCGGA
GCGCTGCGGATGGACAGGGGCTGGGACACGTTCGCCGCCGATCCCTCGCTCGGCAGGCCG
TGGATGCGGATGGACGGACGGCGGGTGTTCCGCTGGGCGATGGACGAGGTGACCCCGCGG
GCGGCGGAACTGCTGCGGGAGAGCGGGATCGAGCCGGAGGCGCTGGACGCCTTCGTCCCG
CACCAGGCGAACCTGCGCATGATCGAGCTGATGGCCGAACGGCTCGGCCTGCCGGAGCGC
ACGGCCGTGGCGCGGGACGTGGTGCGCGCCGGGAACACCTCGGCGGCCTCGGTCCCGCTC
GCGCTGGAGGCGCTCCTCGACTCCGGCGAGGTGGGCAGCGGGGACCGCGCGCTCCTCGTG
GGGTTCGGCGCGGGGCTCAACTACGCGGCCCAGGTGGTGGAGCTCCCGTGA
KS14..335
KS40..1005

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004655 Beta-ketoacyl-acyl carrier protein synthase III (FabH) (Family)
 [16-334]  3.19999999999996e-96 TIGR00747
TIGR00747   FabH
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [245-334]  2.2e-30 PF08541
PF08541   ACP_syn_III_C
IPR013751 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III (Domain)
 [119-186]  1.1e-22 PF08545
PF08545   ACP_syn_III
IPR016038 Thiolase-like, subgroup (Domain)
 [16-172]  2.99999999999998e-49 G3DSA:3.40.47.10 [173-334]  1.09999999999999e-42 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [15-335]  2.80000504261099e-49 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit