close all open/close all

CDS information : Fren_00100


close this sectionLocation

Organism
StrainAK24158
Entry nameFrenolicin
Contig
Start / Stop / Direction12,736 / 12,993 / + [in whole cluster]
12,736 / 12,993 / + [in contig]
Location12736..12993 [in whole cluster]
12736..12993 [in contig]
TypeCDS
Length258 bp (85 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productacyl carrier protein
Product (GenBank)acyl carrier protein
GenefrnJ
frenJ
Gene (GenBank)frnJ
EC number
Keyword
Note
Note (GenBank)
  • FrnJ; second ACP for putative starter unit
Reference
ACC
PmId
[12767243] Ketosynthases in the initiation and elongation modules of aromatic polyketide synthases have orthogonal acyl carrier protein specificity. (Biochemistry. , 2003)
Related Reference
ACC
Q9F6D5
NITE
R1128_00070
PmId
[11732905] In vitro reconstitution and analysis of the chain initiating enzymes of the R1128 polyketide synthase. (Biochemistry. , 2001)
[12767243] Ketosynthases in the initiation and elongation modules of aromatic polyketide synthases have orthogonal acyl carrier protein specificity. (Biochemistry. , 2003)
[19292437] Biosynthesis of aromatic polyketides in bacteria. (Acc Chem Res. , 2009)

close this sectionPKS/NRPS Module

ACP5..78

close this sectionSequence

selected fasta
>acyl carrier protein [acyl carrier protein]
MSAFTLTEFKKLVEQSYDAESAEALHGQALDTSFTDLGYDSLTVYEIVTRIQDEHGVTVP
DEELDLLDTPRALIAYVDARAGSRT
selected fasta
>acyl carrier protein [acyl carrier protein]
ATGAGCGCCTTCACTCTCACCGAGTTCAAGAAGCTGGTCGAGCAGAGCTACGACGCCGAA
TCGGCCGAAGCCCTCCACGGGCAGGCCCTCGACACGAGCTTCACCGATCTGGGTTACGAC
TCGCTGACGGTCTACGAGATCGTCACCCGCATCCAGGACGAGCACGGAGTCACCGTGCCC
GACGAGGAGCTGGACCTCCTCGACACCCCGCGCGCCCTCATCGCGTACGTCGACGCGCGC
GCGGGTTCCCGCACCTGA
ACP5..78
ACP13..234

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003231 Acyl carrier protein (ACP) (Family)
 [38-80]  0.009 PD000887
PD000887   ACP_TREPA_O83786;
IPR009081 Acyl carrier protein-like (Domain)
 [29-77]  2.3e-12 PF00550
PF00550   PP-binding
 [6-81]  2.2e-15 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [1-84]  6e-13 SSF47336
SSF47336   ACP-like
 [5-78]  16.625 PS50075
PS50075   ACP_DOMAIN
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [15-81]  0.0074 SM00823
SM00823   Phosphopantetheine attachment site
SignalP
 [1-24]  0.055 Signal
Eukaryota   
TMHMM No significant hit