close all open/close all

CDS information : Fren_00110


close this sectionLocation

Organism
StrainAK24158
Entry nameFrenolicin
Contig
Start / Stop / Direction14,136 / 13,081 / - [in whole cluster]
14,136 / 13,081 / - [in contig]
Locationcomplement(13081..14136) [in whole cluster]
complement(13081..14136) [in contig]
TypeCDS
Length1,056 bp (351 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative acyl-ACP thioesterase
Product (GenBank)putative acyltransferase for starter unit
Gene
Gene (GenBank)frnK
EC number
Keyword
  • type II thioesterase
  • non-acetate starter unit
Note
Note (GenBank)
  • FrnK; Streptomyces peucetius DpsD homolog
Reference
ACC
Related Reference
ACC
Q9KHK3
NITE
Enter_00120
PmId
[21531566] Policing starter unit selection of the enterocin type II polyketide synthase by the type II thioesterase EncL. (Bioorg Med Chem. , 2011)
ACC
Q9F6D9
NITE
R1128_00030
PmId
[15260498] The acyltransferase homologue from the initiation module of the R1128 polyketide synthase is an acyl-ACP thioesterase that edits acetyl primer units. (Biochemistry. , 2004)

close this sectionSequence

selected fasta
>putative acyl-ACP thioesterase [putative acyltransferase for starter unit]
MRSEGGTEEEGAPVVALLLPGQGAQRARMAAGLHGVVPEFTTAVEECFAVWGTWGEELRA
RWLDGAGGEEALERAAVAQPLLFAVGYGLGRALGAGAQGAPHLLLGHSVGELAAAALAGV
CAPGAALRLLAERDAVLRAAPSGGMLAVAAPVDDLRPYVGADVVVGAVNGPRQTVLCGPE
APLRAVARRLADDGLTARRLQADVPFHSPALAGAARRLTRASAERVARWRPPAVPLWSGR
TGRALTPGEAVRAAFWCGQLAAPVLYWPALGNLLATATATATTTGGGRGVVLLDASPDGS
LGAPARRHPAVRSGAARVVRLLPARPGDPADDVRAFRAALQQAGQVVRDGG
selected fasta
>putative acyl-ACP thioesterase [putative acyltransferase for starter unit]
GTGCGGAGCGAGGGCGGTACGGAGGAGGAGGGCGCCCCGGTGGTGGCCCTGCTGCTGCCC
GGTCAGGGCGCGCAGCGGGCCCGGATGGCGGCCGGACTCCACGGCGTGGTGCCGGAGTTC
ACGACCGCGGTGGAGGAGTGCTTCGCCGTGTGGGGCACCTGGGGGGAGGAGTTGCGCGCG
CGGTGGCTGGACGGGGCGGGCGGCGAGGAGGCGCTGGAACGGGCCGCTGTCGCGCAGCCG
TTGCTCTTCGCCGTGGGGTACGGGCTCGGGCGGGCGCTCGGCGCGGGGGCGCAGGGTGCG
CCGCACCTGTTGCTCGGGCACAGCGTCGGCGAACTCGCCGCCGCCGCGCTCGCCGGGGTG
TGCGCGCCGGGGGCGGCGCTCCGGCTGCTCGCCGAACGGGACGCGGTGCTGCGCGCGGCG
CCGTCCGGGGGCATGCTCGCCGTGGCCGCGCCGGTGGACGACCTGCGCCCGTACGTGGGG
GCCGACGTGGTGGTGGGCGCGGTGAACGGGCCGCGTCAGACGGTGCTGTGCGGGCCGGAG
GCGCCGCTGCGCGCGGTGGCGCGGCGCCTGGCCGACGACGGGCTGACGGCGCGCCGCCTC
CAGGCGGACGTACCCTTCCACTCCCCCGCCCTCGCCGGGGCGGCGCGGCGTCTGACCAGG
GCGAGCGCGGAACGGGTCGCGCGGTGGCGGCCACCCGCCGTGCCCCTGTGGTCGGGCCGG
ACGGGTCGCGCGCTCACGCCGGGCGAGGCGGTGCGCGCCGCGTTCTGGTGCGGTCAGCTC
GCCGCCCCCGTCCTGTACTGGCCGGCGCTGGGGAACCTGCTCGCGACGGCGACGGCGACG
GCGACGACCACGGGCGGCGGGCGTGGCGTGGTGCTGCTCGACGCCTCGCCGGACGGCAGT
CTCGGCGCCCCGGCGCGCCGTCATCCGGCCGTCCGCTCGGGCGCGGCCCGTGTCGTTCGG
CTCCTGCCCGCGCGTCCCGGCGACCCCGCGGACGACGTGCGGGCCTTTCGCGCCGCGCTC
CAACAGGCGGGTCAGGTCGTACGGGACGGGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [7-140]  1e-35 G3DSA:3.40.366.10 [204-309]  1e-35 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR014043 Acyl transferase (Domain)
 [19-279]  8.80000000000003e-32 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [15-275]  1.10000150671642e-32 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [141-203]  2.19999900980708e-13 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
SignalP No significant hit
TMHMM No significant hit