close all open/close all

CDS information : Fren_00120


close this sectionLocation

Organism
StrainAK24158
Entry nameFrenolicin
Contig
Start / Stop / Direction14,336 / 15,613 / + [in whole cluster]
14,336 / 15,613 / + [in contig]
Location14336..15613 [in whole cluster]
14336..15613 [in contig]
TypeCDS
Length1,278 bp (425 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)ketoacyl synthase
GenefrnL
fren-ORF1
Gene (GenBank)frnL
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • FrnL; ORF1 of Bibb et al
Reference
ACC
PmId
[8181754] Cloning, sequencing and deduced functions of a cluster of Streptomyces genes probably encoding biosynthesis of the polyketide antibiotic frenolicin. (Gene. , 1994)
Related Reference
ACC
Q54495
NITE
Nogl_00370
PmId
[8668120] A gene cluster involved in nogalamycin biosynthesis from Streptomyces nogalater: sequence analysis and complementation of early-block mutations in the anthracycline pathway. (Mol Gen Genet. , 1996)

close this sectionPKS/NRPS Module

KS3..375

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [ketoacyl synthase]
MNRQVAVTGIGVVAPGGIGRKPYWEQLTSGRTATRAISFFDASPFRSRIAAEVDFDPAAA
GLSPREVRRMDRAAQFAVVSARESLADSGLDVADLDPHRIGVSIGSAVGGTTSLEREYLA
LSDSGRQWELDLSYLSPHLYDAFTPSSLAREVAGVIGAEGPAAVVSTGCTSGIDSLGHAR
DLIAEGSADVVLAGGTDTPISPIAVACFDAIKATSPSNDDPAHASRPFDRERNGFVLAEG
AAVLVLEELGHARARDAHVYALVSGYATRCNAYHMTGLTPHGREMAEAIRHALAESGTDP
AAVDYVNAHGSGTKQNDRHETAAFKATLGERARSVPVSSIKSMIGHSLGAIGSLEIAAWA
LAMEYGVVPPTANLDTPDPECDLDYVPHEARETRVDRVLSVGSGFGGFQSAMVLTRDTGA
RLPTA
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [ketoacyl synthase]
GTGAACCGACAAGTCGCCGTCACCGGCATCGGCGTGGTGGCTCCGGGAGGGATCGGGCGC
AAGCCGTACTGGGAGCAGCTCACCTCCGGACGCACCGCCACGCGCGCCATCTCCTTCTTC
GACGCCTCGCCCTTCCGCTCGCGGATCGCCGCCGAGGTCGACTTCGACCCCGCGGCGGCG
GGCCTGAGCCCGCGCGAGGTCCGCCGCATGGACCGGGCCGCGCAGTTCGCCGTCGTGAGC
GCCAGGGAGAGCCTCGCCGACAGCGGACTCGACGTCGCCGACCTCGACCCCCACCGGATC
GGGGTGAGCATCGGCAGCGCCGTGGGCGGGACCACCTCGCTGGAACGCGAGTACCTCGCC
CTCAGCGACAGCGGGCGACAGTGGGAACTCGACCTCTCCTACCTCTCGCCGCACCTCTAC
GACGCCTTCACCCCCAGCTCGCTCGCCCGCGAGGTGGCCGGGGTGATCGGCGCGGAGGGG
CCCGCGGCAGTCGTCTCCACCGGCTGCACCTCCGGCATCGACTCGCTCGGCCACGCCCGC
GACCTCATCGCCGAGGGCAGCGCCGACGTCGTGCTCGCGGGCGGCACCGACACCCCCATC
TCGCCGATCGCCGTCGCCTGCTTCGACGCCATCAAGGCCACCTCGCCCAGCAACGACGAC
CCGGCGCACGCCTCGCGCCCCTTCGACAGGGAACGCAACGGCTTCGTCCTCGCGGAGGGC
GCCGCCGTCCTCGTGCTGGAGGAGCTGGGGCACGCGCGGGCCCGCGACGCCCACGTCTAC
GCTCTCGTGTCCGGCTACGCCACGCGCTGCAACGCGTACCACATGACCGGGCTCACCCCG
CACGGCAGGGAGATGGCCGAGGCGATCCGGCACGCGCTCGCCGAGAGCGGGACCGACCCC
GCCGCCGTGGACTACGTCAACGCCCACGGCTCCGGCACCAAGCAGAACGACCGGCACGAG
ACCGCCGCCTTCAAGGCCACGCTCGGCGAGCGGGCCAGGAGCGTGCCGGTCAGCTCCATC
AAGTCGATGATCGGCCACTCGCTCGGTGCCATCGGTTCGCTGGAGATCGCGGCCTGGGCG
CTCGCCATGGAGTACGGCGTGGTGCCGCCCACCGCCAACCTCGACACGCCCGACCCCGAG
TGCGACCTCGACTACGTGCCCCACGAGGCGCGCGAGACGCGGGTGGACAGGGTCCTGAGC
GTCGGCAGCGGCTTCGGCGGTTTCCAGAGCGCCATGGTCCTCACCCGGGACACGGGCGCC
CGCCTCCCGACGGCCTGA
KS3..375
KS7..1125

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [3-250]  1.6e-61 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [260-375]  2.50000000000001e-39 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [7-264]  1.10000000000001e-67 G3DSA:3.40.47.10 [270-416]  1.09999999999999e-54 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-257]  2.0000139277205e-69 SSF53901 [219-416]  2.89997807423187e-66 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [160-176]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP
 [1-19]  0.113 Signal
Eukaryota   
TMHMM No significant hit