close all open/close all

CDS information : Fren_00130


close this sectionLocation

Organism
StrainAK24158
Entry nameFrenolicin
Contig
Start / Stop / Direction15,694 / 16,974 / + [in whole cluster]
15,694 / 16,974 / + [in contig]
Location15694..16974 [in whole cluster]
15694..16974 [in contig]
TypeCDS
Length1,281 bp (426 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)chain length factor
GenefrnM
fren-ORF2
Gene (GenBank)frnM
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • FrnM; noncatalytic subunit of KAS; ORF2 of Bibb et al
Reference
ACC
PmId
[8181754] Cloning, sequencing and deduced functions of a cluster of Streptomyces genes probably encoding biosynthesis of the polyketide antibiotic frenolicin. (Gene. , 1994)

close this sectionPKS/NRPS Module

CLF21..378

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [chain length factor]
MTTAPSRTAQGAPPGAALPPVFTGIGVAAPNGLGTEEWWAATLRGEHGLRPVTEYDASGH
PGGLVGRVPDFDAARHLPGRLLPQTDRVTRLALVAADEALKDAAVDPARLPEYGASAVTS
NATGGFEFTHREIRKLWTEGPARVSVYESFAWFYAVNTGQISIRHGMRGPGAVVVADQAG
GLDALGQARRVLRKGGVLAVSGGVESALDPWGLAAHASSGTLSRSGDPATAYLPFDRRAL
GTVVGEGGALLTLETPRHAEERDAPRIYGELAGYAATFDPPAGSGRPPGLERAARLALAD
AGLAPGDVDVVFADAAGLPAADAAEAAALRALFGPGGVPVSVPKTQTGRLASGGPALDVA
AALLALRDGLVPPAVHLDEVDPAYGLDLVRDTPRALPLRTALVLARGHGGFNAAVVVRGR
RRPRTA
selected fasta
>polyketide synthase chain length factor subunit [chain length factor]
ATGACCACCGCCCCCTCCCGCACCGCCCAGGGCGCCCCTCCCGGGGCCGCCCTGCCCCCC
GTCTTCACCGGCATCGGCGTCGCCGCCCCCAACGGGCTCGGCACCGAGGAGTGGTGGGCG
GCCACCCTGCGCGGGGAGCACGGTCTGCGGCCCGTCACGGAGTACGACGCGAGCGGCCAC
CCCGGTGGACTCGTCGGCCGCGTCCCGGACTTCGACGCCGCCCGCCACCTGCCCGGCCGC
CTCCTGCCGCAGACCGACCGGGTCACCCGGCTCGCGCTCGTCGCCGCCGACGAGGCACTG
AAGGACGCCGCCGTCGACCCGGCCCGGCTGCCCGAGTACGGGGCGAGCGCCGTCACCTCC
AACGCCACCGGCGGCTTCGAGTTCACCCACCGCGAGATCCGCAAACTCTGGACCGAGGGC
CCGGCCCGCGTCAGCGTCTACGAGTCCTTCGCCTGGTTCTACGCCGTCAACACCGGCCAG
ATCTCCATCCGGCACGGCATGCGCGGCCCCGGCGCCGTCGTCGTGGCCGACCAGGCGGGC
GGCCTCGACGCCCTCGGCCAGGCCCGCCGCGTACTGCGCAAGGGCGGGGTGCTGGCGGTG
AGCGGCGGCGTGGAGTCCGCGCTCGACCCCTGGGGCCTGGCCGCCCACGCCTCGTCGGGC
ACCCTCAGCCGCTCCGGCGACCCGGCCACCGCCTACCTCCCCTTCGACCGGCGTGCCCTC
GGCACCGTCGTCGGCGAGGGCGGCGCCCTCCTCACCCTGGAGACACCCCGGCACGCCGAG
GAGCGCGACGCACCCCGGATCTACGGCGAACTCGCCGGGTACGCCGCCACGTTCGACCCG
CCCGCGGGCTCCGGACGGCCCCCCGGCCTCGAACGCGCCGCGCGCCTCGCCCTCGCCGAC
GCGGGCCTGGCACCCGGGGACGTCGACGTCGTCTTCGCGGACGCGGCGGGGCTCCCCGCC
GCCGACGCCGCCGAGGCCGCCGCCCTGCGCGCGCTCTTCGGCCCCGGCGGCGTTCCGGTG
AGCGTGCCGAAGACCCAGACCGGGCGGCTCGCCTCGGGCGGCCCGGCCCTCGACGTCGCC
GCCGCCCTCCTCGCCCTGCGCGACGGCCTCGTGCCCCCGGCCGTCCACCTCGACGAGGTC
GATCCCGCGTACGGCCTCGACCTCGTCCGCGACACCCCGCGCGCCCTCCCGCTGCGCACG
GCGCTCGTCCTCGCGCGCGGCCACGGCGGCTTCAACGCGGCCGTCGTCGTCCGCGGGCGG
CGGCGGCCCCGTACCGCCTGA
CLF21..378
CLF61..1134

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [21-255]  8.1e-46 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [268-378]  4.6e-25 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [22-273]  7.59999999999998e-46 G3DSA:3.40.47.10 [284-418]  1.9e-38 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [17-264]  1.60000240695997e-52 SSF53901 [227-420]  2.1000026783403e-46 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-28]  0.588 Signal
Eukaryota   
 [1-28]  0.424 Signal
Bacteria, Gram-positive   
 [1-11]  0.539 Signal
Bacteria, Gram-negative   
TMHMM No significant hit