close all open/close all

CDS information : Fren_00140


close this sectionLocation

Organism
StrainAK24158
Entry nameFrenolicin
Contig
Start / Stop / Direction17,047 / 17,298 / + [in whole cluster]
17,047 / 17,298 / + [in contig]
Location17047..17298 [in whole cluster]
17047..17298 [in contig]
TypeCDS
Length252 bp (83 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyl carrier protein subunit
Product (GenBank)acyl carrier protein
GenefrnN
fren-ORF3
Gene (GenBank)frnN
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • FrnN; ORF3 of Bibb et al
Reference
ACC
PmId
[8181754] Cloning, sequencing and deduced functions of a cluster of Streptomyces genes probably encoding biosynthesis of the polyketide antibiotic frenolicin. (Gene. , 1994)
[8468280] Genetic construction and functional analysis of hybrid polyketide synthases containing heterologous acyl carrier proteins. (J Bacteriol. , 1993)
[7972098] Engineered biosynthesis of novel polyketides: influence of a downstream enzyme on the catalytic specificity of a minimal aromatic polyketide synthase. (Proc Natl Acad Sci U S A. , 1994)
[12705828] Solution structure and backbone dynamics of the holo form of the frenolicin acyl carrier protein. (Biochemistry. , 2003)
Related Reference
ACC
Q02054
NITE
Actino_00200
PmId
[16285746] Self-malonylation is an intrinsic property of a chemically synthesized type II polyketide synthase acyl carrier protein. (Biochemistry. , 2005)
[19361520] Probing the Interactions of early polyketide intermediates with the Actinorhodin ACP from S. coelicolor A3(2). (J Mol Biol. , 2009)
[19381365] Preliminary kinetic analysis of acyl carrier protein-ketoacylsynthase interactions in the actinorhodin minimal polyketide synthase. (Mol Biosyst. , 2009)

close this sectionPKS/NRPS Module

ACP5..77

close this sectionSequence

selected fasta
>polyketide synthase acyl carrier protein subunit [acyl carrier protein]
MSALTVDDLKKLLAETAGEDDSVDLAGELDTPFVDLGYDSLALLETAAVLQQRYGIALTD
ETVGRLGTPRELLDEVNTTPATA
selected fasta
>polyketide synthase acyl carrier protein subunit [acyl carrier protein]
ATGAGCGCACTGACCGTCGACGACCTCAAGAAACTGCTCGCCGAGACCGCCGGGGAGGAC
GACAGCGTCGACCTCGCCGGAGAACTCGACACGCCCTTCGTGGACCTCGGCTACGACTCC
CTCGCGCTGCTGGAGACGGCCGCCGTGCTCCAGCAGCGGTACGGCATCGCGCTGACTGAC
GAGACGGTCGGCCGGCTGGGCACCCCGCGCGAACTGCTCGACGAGGTCAACACCACCCCG
GCCACCGCCTGA
ACP5..77
ACP13..231

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [2-83]  7.70000171387738e-14 SSF47336
SSF47336   ACP_like
 [5-78]  2.1e-17 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [8-76]  7.7e-11 PF00550
PF00550   PP-binding
 [5-77]  PS50075
PS50075   ACP_DOMAIN
SignalP No significant hit
TMHMM No significant hit