close all open/close all

CDS information : Fren_00150


close this sectionLocation

Organism
StrainAK24158
Entry nameFrenolicin
Contig
Start / Stop / Direction17,862 / 17,380 / - [in whole cluster]
17,862 / 17,380 / - [in contig]
Locationcomplement(17380..17862) [in whole cluster]
complement(17380..17862) [in contig]
TypeCDS
Length483 bp (160 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)actVI-ORFA homolog
GenefrnO
fren-ORFX
Gene (GenBank)frnO
EC number
Keyword
Note
Note (GenBank)
  • FrnO; ORFX of Bibb et al
Reference
ACC
PmId
[8181754] Cloning, sequencing and deduced functions of a cluster of Streptomyces genes probably encoding biosynthesis of the polyketide antibiotic frenolicin. (Gene. , 1994)
Related Reference
ACC
Q53925
NITE
Actino_00020
PmId
[17227452] Possible involvement of ActVI-ORFA in transcriptional regulation of actVI tailoring-step genes for actinorhodin biosynthesis. (FEMS Microbiol Lett. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [actVI-ORFA homolog]
MTTTTPPDDVRAGSLPGDAARSAALYTEVQAFYARQAHHLDAVRAEEFAATFAAEGVFAH
SPDTPAARGRAAIAEEVRGFNARRFADDPVQRRHWFSMLDVRPGEDGAVETEFYALVVVT
RPDAALPVIGPSCVVRDVLVREGGELRTLSRQVTQDRTLL
selected fasta
>hypothetical protein [actVI-ORFA homolog]
GTGACGACCACCACCCCGCCGGACGACGTGAGGGCCGGGTCCCTGCCGGGCGACGCGGCG
CGTTCCGCGGCGCTCTACACCGAGGTACAGGCGTTCTACGCGCGCCAGGCACACCACCTG
GACGCGGTACGGGCCGAGGAGTTCGCGGCCACCTTCGCGGCGGAGGGCGTCTTCGCCCAC
TCCCCCGACACCCCGGCGGCCCGGGGCAGGGCGGCGATCGCGGAGGAGGTGCGCGGCTTC
AACGCCCGCCGGTTCGCCGACGACCCCGTCCAGCGGCGGCACTGGTTCTCGATGCTGGAC
GTACGCCCGGGTGAGGACGGCGCCGTCGAGACGGAGTTCTACGCGCTGGTCGTGGTGACC
CGGCCGGACGCGGCGCTCCCGGTGATCGGTCCCAGTTGCGTCGTACGGGACGTCCTGGTG
CGGGAGGGCGGGGAACTGCGCACGCTGTCGCGGCAGGTGACCCAGGACCGCACCTTGCTG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit