close all open/close all

CDS information : Fren_00160


close this sectionLocation

Organism
StrainAK24158
Entry nameFrenolicin
Contig
Start / Stop / Direction18,015 / 18,830 / + [in whole cluster]
18,015 / 18,830 / + [in contig]
Location18015..18830 [in whole cluster]
18015..18830 [in contig]
TypeCDS
Length816 bp (271 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative polyketide C-9 ketoreductase
Product (GenBank)ketoreductase
GenefrnP
fren-ORF5
Gene (GenBank)frnP
EC number
Keyword
Note
Note (GenBank)
  • FrnP; ORF5 of Bibb et al
Reference
ACC
PmId
[8181754] Cloning, sequencing and deduced functions of a cluster of Streptomyces genes probably encoding biosynthesis of the polyketide antibiotic frenolicin. (Gene. , 1994)
Related Reference
ACC
Q8VWB5
PmId
[8157619] Nucleotide sequence of the aknA region of the aklavinone biosynthetic gene cluster of Streptomyces galilaeus. (J Bacteriol. , 1994)
ACC
P16544
NITE
Actino_00170
PmId
[2394677] Biosynthesis of anthraquinones by interspecies cloning of actinorhodin biosynthesis genes in streptomycetes: clarification of actinorhodin gene functions. (J Bacteriol. , 1990)
[15458634] The crystal structure of the actIII actinorhodin polyketide reductase: proposed mechanism for ACP and polyketide binding. (Structure. , 2004)
[18205400] Inhibition kinetics and emodin cocrystal structure of a type II polyketide ketoreductase. (Biochemistry. , 2008)
[18691223] Localization of the ActIII actinorhodin polyketide ketoreductase to the cell wall. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>putative polyketide C-9 ketoreductase [ketoreductase]
MTTAAPHTRPGEAGTTRGPALVTGATRGIGLAVAEALVARGYPVVVCARDAEAVARTVKE
LAAGGARVEGVVADVTDAASVHELVATTVARFGPVEVLVNNAGRSGGGVTAELSESLWDD
VIATNLKSVFLVTREVLTTGGMTGRGRGVVNIASTGGKQGVVFGAPYSASKHGVVGFTKA
LGLELARSGITVNAVCPGYVETPMAAGVRRHYADLWDVTEEDVLARFEAKIPLGRYTRPD
EVAALVDYLVTDAAAAVTAQALNVCGGLGNY
selected fasta
>putative polyketide C-9 ketoreductase [ketoreductase]
ATGACCACAGCAGCTCCGCACACCCGCCCCGGGGAGGCAGGCACCACCCGGGGACCCGCT
CTCGTGACCGGCGCGACCCGGGGCATCGGCCTCGCCGTCGCCGAGGCGCTCGTCGCGCGC
GGCTATCCCGTGGTGGTCTGCGCCCGCGACGCCGAGGCGGTCGCGCGCACCGTCAAGGAG
CTGGCAGCGGGCGGCGCCCGCGTCGAGGGCGTCGTCGCCGACGTCACCGACGCCGCCTCC
GTGCACGAACTCGTCGCCACCACCGTCGCCCGCTTCGGCCCCGTCGAGGTCCTCGTCAAC
AACGCGGGCCGGTCCGGCGGCGGAGTGACCGCCGAACTCAGCGAGTCCCTGTGGGACGAC
GTCATCGCCACCAACCTCAAGAGCGTCTTCCTGGTCACCCGGGAGGTGCTCACCACGGGC
GGGATGACCGGGCGCGGCCGCGGCGTCGTCAACATCGCCTCCACGGGCGGCAAGCAGGGC
GTCGTCTTCGGCGCCCCCTACTCGGCGTCCAAGCACGGCGTCGTCGGCTTCACCAAAGCC
CTCGGCCTCGAACTGGCCCGGAGCGGCATCACCGTCAACGCCGTCTGCCCCGGCTACGTC
GAGACGCCGATGGCCGCCGGAGTGCGCCGCCACTACGCCGACCTGTGGGACGTCACCGAG
GAGGACGTGCTGGCCCGCTTCGAGGCGAAGATCCCGCTCGGCCGGTACACCCGCCCCGAC
GAGGTCGCCGCCCTCGTCGACTACCTGGTCACCGACGCCGCCGCGGCCGTCACCGCCCAG
GCCCTCAACGTGTGCGGCGGACTGGGGAACTACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [20-185]  2.29999999999998e-34 PF00106
PF00106   adh_short
 [93-104]  2.09999806691534e-11 PR00080 [147-155]  2.09999806691534e-11 PR00080 [167-186]  2.09999806691534e-11 PR00080
PR00080   SDRFAMILY
 [1-269]  3.0999994589937e-15 PIRSF000126
PIRSF000126   11-beta-HSD1
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [19-36]  2.9000035467798e-41 PR00081 [93-104]  2.9000035467798e-41 PR00081 [141-157]  2.9000035467798e-41 PR00081 [167-186]  2.9000035467798e-41 PR00081 [188-205]  2.9000035467798e-41 PR00081 [232-252]  2.9000035467798e-41 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [20-268]  1.60000000000002e-76 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [154-182]  PS00061
PS00061   ADH_SHORT
SignalP No significant hit
TMHMM No significant hit