close all open/close all

CDS information : Fren_00170


close this sectionLocation

Organism
StrainAK24158
Entry nameFrenolicin
Contig
Start / Stop / Direction18,830 / 19,825 / + [in whole cluster]
18,830 / 19,825 / + [in contig]
Location18830..19825 [in whole cluster]
18830..19825 [in contig]
TypeCDS
Length996 bp (331 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/dehydratase
Product (GenBank)aromatase
GenefrnQ
fren-ORF4
Gene (GenBank)frnQ
EC number
Keyword
  • 1st ring
Note
Note (GenBank)
  • FrnQ; actVII homolog; ORF4 of Bibb et al
Reference
ACC
PmId
[8181754] Cloning, sequencing and deduced functions of a cluster of Streptomyces genes probably encoding biosynthesis of the polyketide antibiotic frenolicin. (Gene. , 1994)
Related Reference
ACC
Q02055
NITE
Actino_00210
PmId
[11851466] Genetic Contributions to Understanding Polyketide Synthases. (Chem Rev. , 1997)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [aromatase]
MTTTTTGHQRPGSAEHSARLAAPPASAYELVADVTRWPLLFTPCLHAEVLESGPGTERVR
LWALTGEQVRGWTSRRTLDSEGLRVGFRQEDSAPPLAAMGGEWRFTEEGEDTRAVLAHDW
TLTEPGAAPHRWVTETLDRNSTAEIGAVTAWAARTHAAGGADALLFSFTDSLDIAAPAPD
VYAFLDAADQWPARLPHVSRVAFSTTPATPLTAGAEVQHLEMETRADDGTRHLTRSIRLG
FAGRLLVYKQTTLPAPLLGHAGSWALEPLPGGGTRVTARHRVALDPDAVTERFGAGTTLA
AARDTVRALLGGNSRRTLEAARAHTESAGER
selected fasta
>putative cyclase/dehydratase [aromatase]
ATGACCACCACCACGACCGGGCACCAGCGCCCCGGCTCCGCCGAACACTCCGCGCGCCTC
GCCGCCCCGCCCGCCTCCGCCTACGAACTCGTCGCCGACGTGACGCGCTGGCCCCTCCTC
TTCACCCCGTGCCTGCACGCCGAGGTGCTGGAGAGCGGTCCCGGCACCGAACGCGTGCGG
CTGTGGGCCCTCACCGGCGAGCAGGTGCGCGGCTGGACCTCGCGGCGCACCCTCGACAGC
GAGGGCCTGCGCGTCGGCTTCCGCCAGGAGGACAGCGCCCCGCCGCTCGCCGCGATGGGC
GGGGAGTGGCGCTTCACCGAGGAGGGCGAGGACACGCGCGCCGTACTCGCGCACGACTGG
ACGCTCACCGAGCCGGGCGCCGCACCGCACCGCTGGGTCACCGAGACACTCGACCGCAAC
AGCACCGCCGAGATCGGGGCCGTGACCGCCTGGGCCGCGCGCACCCACGCGGCGGGCGGC
GCCGACGCGCTGCTCTTCTCCTTCACCGACAGCCTCGACATCGCCGCCCCCGCGCCCGAC
GTGTACGCCTTCCTCGACGCCGCCGACCAGTGGCCCGCGCGGCTCCCGCACGTCAGCCGG
GTCGCCTTCTCGACCACCCCGGCGACGCCGCTCACGGCGGGCGCGGAGGTGCAGCACCTG
GAGATGGAGACGCGCGCGGACGACGGCACGCGCCACCTCACCCGCTCGATCCGCCTCGGC
TTCGCGGGCCGTCTCCTCGTCTACAAGCAGACCACGTTGCCCGCCCCGCTCCTCGGCCAC
GCCGGCTCCTGGGCGCTGGAGCCGCTGCCCGGCGGCGGCACCCGGGTCACCGCCCGCCAC
CGGGTGGCACTCGACCCGGACGCCGTGACCGAACGCTTCGGCGCGGGGACCACGCTCGCG
GCGGCGCGGGACACGGTACGGGCGCTGCTCGGCGGCAACAGCAGGCGCACCCTGGAGGCG
GCCCGCGCCCACACCGAGTCGGCGGGGGAGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005031 Streptomyces cyclase/dehydrase (Family)
 [20-137]  2.5e-10 PF03364
PF03364   Polyketide_cyc
IPR019587 Polyketide cyclase/dehydrase (Family)
 [167-324]  9.60000000000001e-09 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [15-119]  1.7e-12 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP
 [1-39]  0.057 Signal
Eukaryota   
 [1-27]  0.233 Signal
Bacteria, Gram-positive   
 [1-27]  0.239 Signal
Bacteria, Gram-negative   
TMHMM No significant hit