close all open/close all

CDS information : Fren_00180


close this sectionLocation

Organism
StrainAK24158
Entry nameFrenolicin
Contig
Start / Stop / Direction19,822 / 20,766 / + [in whole cluster]
19,822 / 20,766 / + [in contig]
Location19822..20766 [in whole cluster]
19822..20766 [in contig]
TypeCDS
Length945 bp (314 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/dehydratase
Product (GenBank)cyclase/dehydrase
Gene
Gene (GenBank)frnR
EC number
Keyword
  • 2nd ring
Note
Note (GenBank)
  • FrnR; actIV homolog
Reference
ACC
Related Reference
ACC
Q9X466
NITE
Naphcy_00060
PmId
[10206788] Isolation and characterization of the naphthocyclinone gene cluster from Streptomyces arenae DSM 40737 and heterologous expression of the polyketide synthase genes. (Gene. , 1999)
ACC
Q93IZ0
NITE
Actino_00220
PmId
[11851466] Genetic Contributions to Understanding Polyketide Synthases. (Chem Rev. , 1997)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [cyclase/dehydrase]
MTTTGPATPLAPGPASAETVALADGVHSWLQPDGGWCVSNAGILLAPDRVALVDTAATEA
RSRALGAAVAGLSPHPVRLLVNTHFHGDHSFGNGILGKDAVIVAHERTRTEMAEAGLGLT
GLWPGVDWGHVDPVLPQLTYRRRLTLHHGDLRVELIHPGPAHTTNDTLVWLPEQRVLFAG
DVLLPGATPFVLMGSVTGSLHTLRLLRRLGPRVVVGGHGPLAGPEVIEETERYLLRLRRI
ATEGHAAGLTPLEAARRHGPGPFAHWSEPERLAANLHRAYAELGPAPLGTPLDVLACFGD
LIAYNDGELPVSHA
selected fasta
>putative cyclase/dehydratase [cyclase/dehydrase]
ATGACCACGACCGGCCCCGCGACTCCCCTGGCCCCCGGGCCCGCATCCGCCGAGACCGTC
GCGCTCGCCGACGGCGTGCACTCCTGGCTCCAGCCCGACGGCGGCTGGTGCGTCAGCAAC
GCGGGCATCCTGCTCGCGCCCGACCGCGTCGCGCTCGTCGACACCGCCGCCACCGAGGCG
CGCTCCCGCGCGCTCGGCGCCGCGGTCGCCGGACTCAGCCCGCATCCCGTGCGACTGCTC
GTCAACACCCACTTCCACGGGGACCACAGCTTCGGCAACGGCATCCTCGGCAAGGACGCC
GTCATCGTCGCCCACGAGCGCACCCGCACCGAGATGGCCGAGGCCGGACTCGGGCTCACC
GGACTGTGGCCGGGCGTGGACTGGGGGCACGTGGACCCGGTCCTGCCCCAGCTCACGTAC
CGCAGGCGCCTCACGCTCCACCACGGGGACCTCCGCGTCGAGCTGATCCACCCCGGCCCG
GCGCACACCACCAACGACACCCTGGTGTGGCTCCCCGAGCAGCGCGTCCTGTTCGCGGGG
GACGTACTCCTGCCGGGGGCGACGCCCTTCGTGCTGATGGGCTCGGTGACCGGCTCGCTG
CACACCCTGCGTCTGCTGCGCCGCCTCGGCCCCCGCGTCGTCGTCGGCGGGCACGGCCCC
CTCGCGGGGCCCGAGGTGATCGAGGAGACGGAGCGCTACCTGCTGCGGCTGCGGCGCATC
GCCACCGAGGGCCACGCCGCGGGGCTCACCCCGCTGGAGGCGGCACGGCGCCACGGCCCC
GGGCCCTTCGCCCACTGGAGCGAGCCGGAACGACTCGCCGCCAATCTGCACCGGGCGTAC
GCCGAACTCGGCCCCGCACCACTGGGCACGCCGCTCGACGTCCTCGCCTGCTTCGGCGAC
CTCATCGCCTACAACGACGGCGAGCTGCCGGTCAGCCACGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001279 Beta-lactamase-like (Domain)
 [38-218]  5.49999338756182e-29 SM00849
SM00849   Lactamase_B
 [36-218]  5.20000000000001e-21 PF00753
PF00753   Lactamase_B
SignalP
 [1-17]  0.936 Signal
Bacteria, Gram-negative   
 [1-17]  0.138 Signal
Eukaryota   
 [1-23]  0.351 Signal
Bacteria, Gram-positive   
TMHMM No significant hit