close all open/close all

CDS information : Fren_00190


close this sectionLocation

Organism
StrainAK24158
Entry nameFrenolicin
Contig
Start / Stop / Direction21,834 / 20,917 / - [in whole cluster]
21,834 / 20,917 / - [in contig]
Locationcomplement(20917..21834) [in whole cluster]
complement(20917..21834) [in contig]
TypeCDS
Length918 bp (305 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)FrnS
Gene
Gene (GenBank)frnS
EC number
Keyword
Note
Note (GenBank)
Reference
ACC

close this sectionSequence

selected fasta
>hypothetical protein [FrnS]
MTGRVTGTMAGPLPGTVLVAGASGAVGGRLVSRLLDSGVPVRALVRSAARGRALAAVGAE
TVVGDLADTASLAAALHGVERAFLLLQDEAGAPFARAAAKARGLREVVVLSATAAAHPEY
DNPMFQKHVRGERHVRGSGVPWVFLRPGAFASLALLWAPALHGDGVVRVPHAGLAVPLID
PRDIADVAAAVLTAPVERWAGKAVPLSGPEVLTLPGRTAVLAAELGRPLRVEPVPEEEWV
QLTARHIPEPYARALAGVERFFTEHPPAVSPGVTDVTGRPARSFATWVRDHAASFAPGPP
TVVGG
selected fasta
>hypothetical protein [FrnS]
GTGACGGGAAGGGTGACGGGAACGATGGCGGGACCACTGCCGGGAACAGTGCTGGTGGCC
GGGGCGAGCGGCGCGGTCGGGGGGCGCCTCGTGTCCCGGCTGCTCGACTCCGGGGTGCCG
GTGCGCGCCCTGGTGCGCTCGGCCGCGCGCGGGCGGGCGCTCGCCGCGGTCGGCGCCGAG
ACGGTCGTCGGGGACCTGGCGGACACGGCTTCGCTCGCGGCGGCGCTGCACGGCGTGGAG
CGGGCGTTCCTGCTGCTCCAGGACGAGGCCGGCGCGCCCTTCGCGCGGGCGGCGGCGAAG
GCGCGGGGGCTGCGCGAGGTGGTGGTGCTCTCCGCGACGGCGGCGGCTCACCCGGAGTAC
GACAACCCGATGTTCCAGAAGCACGTCCGCGGCGAGCGGCACGTGCGCGGGAGCGGGGTG
CCCTGGGTGTTCCTGCGTCCGGGCGCCTTCGCCTCGCTCGCGCTGCTGTGGGCGCCCGCG
CTCCACGGGGACGGTGTGGTGCGGGTCCCGCACGCCGGGCTCGCGGTGCCGCTGATCGAC
CCGCGGGACATCGCCGACGTGGCCGCCGCGGTTCTCACGGCGCCCGTGGAGCGGTGGGCC
GGAAAGGCGGTGCCGCTCTCGGGTCCCGAGGTGCTGACGCTGCCCGGGCGGACCGCCGTG
CTCGCCGCGGAACTGGGCCGCCCGCTGCGCGTGGAGCCGGTGCCGGAGGAGGAGTGGGTG
CAGCTGACGGCCCGGCACATCCCCGAGCCGTACGCGCGGGCGCTCGCGGGCGTCGAGCGG
TTCTTCACGGAGCACCCACCGGCCGTGAGCCCGGGTGTCACCGACGTGACCGGTCGGCCC
GCGCGGTCCTTCGCCACTTGGGTGCGCGACCACGCGGCGAGCTTCGCGCCCGGACCGCCC
ACCGTGGTCGGCGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016040 NAD(P)-binding domain (Domain)
 [16-213]  1e-36 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-19]  0.744 Signal
Bacteria, Gram-negative   
 [1-24]  0.936 Signal
Bacteria, Gram-positive   
 [1-24]  0.92 Signal
Eukaryota   
TMHMM No significant hit