close all open/close all

CDS information : Fren_00200


close this sectionLocation

Organism
StrainAK24158
Entry nameFrenolicin
Contig
Start / Stop / Direction23,021 / 21,831 / - [in whole cluster]
23,021 / 21,831 / - [in contig]
Locationcomplement(21831..23021) [in whole cluster]
complement(21831..23021) [in contig]
TypeCDS
Length1,191 bp (396 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative FMNH2-dependent monooxygenase
Product (GenBank)putative enoyl reductase
Gene
Gene (GenBank)frnT
EC number
Keyword
  • two-component system
  • C-6 quinone formation
Note
Note (GenBank)
  • FrnT; actVA-ORF5 homolog
Reference
ACC
Related Reference
ACC
Q53907
NITE
Actino_00110
PmId
[18245777] Mechanism and regulation of the Two-component FMN-dependent monooxygenase ActVA-ActVB from Streptomyces coelicolor. (J Biol Chem. , 2008)
[19246012] Biosynthesis of actinorhodin and related antibiotics: discovery of alternative routes for quinone formation encoded in the act gene cluster. (Chem Biol. , 2009)
[22086671] Epoxyquinone formation catalyzed by a two-component flavin-dependent monooxygenase involved in biosynthesis of the antibiotic actinorhodin. (Chembiochem. , 2011)
[23601640] Biosynthetic conclusions from the functional dissection of oxygenases for biosynthesis of actinorhodin and related streptomyces antibiotics. (Chem Biol. , 2013)

close this sectionSequence

selected fasta
>putative FMNH2-dependent monooxygenase [putative enoyl reductase]
MTEQSTTLAAPAHAERTGAPDEGPGRPPDRSRNGPGRSPRSRPGTRAAVRRSGVSPGKSS
AGIVAAGFARHFVPAAHGGAEGGFGELAEAVLRLGTGCTSAAWAASLSAYAGRYAAYLPE
EGQAEVWAEGPDALLAGALVPSGTVTPVPGGWRLDGAWPYISGVRHAAWVLACATVPGGE
GEEGPEVRFFAGPRAAPRVERTWNTTGMRATGSDTLVLDDVLVPAHRSFPRTRVLAGQRP
RVAGAVPTVRMARVGALPVVTPLVGAARGALRAWTERAAQGRAPSPGALGELSRAAGEAD
AAELLVLRAAAAADGTVSLPEPAAAVRGKRDTALAAELAVGAVQRLVRASGTSGQSPHDP
VQRFWRDVQTGASHVALSPEAAGAAYGAWAVQEANR
selected fasta
>putative FMNH2-dependent monooxygenase [putative enoyl reductase]
ATGACGGAGCAATCGACCACCCTCGCCGCACCGGCACACGCCGAGCGGACCGGGGCGCCG
GACGAGGGGCCGGGACGCCCCCCGGACCGCTCGCGGAACGGGCCGGGGCGCTCGCCGCGC
TCGCGGCCGGGCACGCGCGCCGCGGTGAGGAGGAGCGGGGTCTCGCCGGGGAAGTCGTCC
GCGGGCATCGTGGCGGCGGGCTTCGCCCGCCACTTCGTGCCCGCGGCCCACGGCGGCGCC
GAAGGCGGCTTCGGGGAACTCGCCGAGGCCGTCCTGCGCCTCGGGACGGGCTGCACCTCG
GCCGCGTGGGCGGCCTCGCTCTCCGCCTACGCCGGGCGGTACGCCGCGTACCTGCCCGAG
GAGGGGCAGGCCGAGGTGTGGGCCGAGGGCCCGGACGCGCTGCTCGCGGGCGCCCTCGTC
CCCTCGGGGACCGTGACGCCCGTCCCCGGCGGCTGGCGGCTCGACGGGGCCTGGCCCTAC
ATCAGCGGCGTGCGGCACGCCGCCTGGGTGCTCGCCTGCGCGACCGTGCCGGGCGGCGAG
GGCGAGGAGGGCCCCGAGGTCCGGTTCTTCGCGGGGCCGCGCGCGGCACCCCGCGTCGAA
CGGACCTGGAACACGACGGGGATGCGCGCGACGGGCAGCGACACCCTCGTGCTCGACGAC
GTCCTCGTCCCCGCGCACCGTTCCTTCCCGCGCACCCGTGTCCTCGCGGGGCAGCGCCCC
CGCGTCGCGGGCGCGGTGCCCACGGTGCGGATGGCGCGGGTCGGGGCACTGCCCGTCGTG
ACGCCGCTCGTCGGCGCGGCGCGGGGCGCCCTGCGGGCGTGGACCGAGCGCGCCGCGCAG
GGGCGGGCGCCTTCGCCCGGAGCACTCGGGGAGCTGAGCCGGGCGGCCGGGGAGGCCGAC
GCGGCCGAGCTGCTCGTGCTGCGCGCGGCGGCGGCGGCCGACGGCACCGTTTCCCTTCCC
GAGCCCGCCGCCGCGGTGCGCGGCAAGCGGGACACGGCCCTCGCCGCCGAGTTGGCCGTC
GGGGCGGTGCAGCGGCTCGTCCGTGCGAGCGGGACGTCCGGGCAGAGCCCGCACGACCCC
GTGCAGCGGTTCTGGCGGGACGTGCAGACCGGCGCCTCGCACGTCGCGCTCTCCCCCGAG
GCCGCGGGCGCCGCCTACGGCGCCTGGGCGGTACAGGAAGCGAACCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [136-222]  6.19999999999999e-26 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [223-392]  9.5e-30 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
 [243-374]  6.40000038788486e-08 SSF47203
SSF47203   AcylCoADH_C_like
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [63-231]  1.29999924468179e-25 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR013107 Acyl-CoA dehydrogenase, type 2, C-terminal (Domain)
 [259-379]  6.90000000000001e-31 PF08028
PF08028   Acyl-CoA_dh_2
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [47-133]  6.40000000000001e-20 G3DSA:1.10.540.10
G3DSA:1.10.540.10   AcylCoA_DH/ox_N
SignalP
 [1-14]  0.557 Signal
Bacteria, Gram-negative   
TMHMM No significant hit