close all open/close all

CDS information : Fren_00210


close this sectionLocation

Organism
StrainAK24158
Entry nameFrenolicin
Contig
Start / Stop / Direction23,432 / 23,106 / - [in whole cluster]
23,432 / 23,106 / - [in contig]
Locationcomplement(23106..23432) [in whole cluster]
complement(23106..23432) [in contig]
TypeCDS
Length327 bp (108 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative oxidoreductase
Product (GenBank)quinone-forming monooxygenase
Gene
Gene (GenBank)frnU
EC number
Keyword
Note
  • This ORF is not actVA-ORF4 homolog.
Note (GenBank)
  • FrnU; actVA-ORF4 homolog
Reference
ACC
Related Reference
ACC
Q8VWB4
PmId
[12399480] Expression, purification, and characterization of AknX anthrone oxygenase, which is involved in aklavinone biosynthesis in Streptomyces galilaeus. (J Bacteriol. , 2002)

close this sectionSequence

selected fasta
>putative oxidoreductase [quinone-forming monooxygenase]
MSGGHMVTMINQMLLHGDESRFLAVLEEICAHMRAQPGFLSLRLHRSPDHPERWAMLADW
SDAAAHRAAASAPGIRPAFARLRAEAHTAPQVYAPVPTPGAPAGDSLA
selected fasta
>putative oxidoreductase [quinone-forming monooxygenase]
GTGTCGGGTGGACACATGGTGACCATGATCAACCAGATGCTCCTGCACGGCGACGAGAGC
CGTTTCCTCGCGGTCCTCGAAGAGATCTGCGCCCACATGCGCGCGCAGCCCGGCTTCCTC
TCCCTGCGCCTGCACCGCTCGCCCGACCACCCCGAGCGGTGGGCCATGCTCGCCGACTGG
AGCGACGCCGCCGCCCACCGGGCGGCGGCGAGCGCCCCCGGCATCCGGCCCGCCTTCGCG
CGGCTGCGCGCCGAGGCCCACACCGCGCCGCAGGTCTACGCCCCGGTGCCCACGCCCGGC
GCACCGGCCGGGGACTCCCTCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007138 Antibiotic biosynthesis monooxygenase (Domain)
 [6-80]  1.6e-16 PF03992
PF03992   ABM
IPR011008 Dimeric alpha-beta barrel (Domain)
 [6-102]  5.10001002358244e-19 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP No significant hit
TMHMM No significant hit