close all open/close all
Fren_00210 Fren_00210   last last

CDS information : Fren_00220


close this sectionLocation

Organism
StrainAK24158
Entry nameFrenolicin
Contig
Start / Stop / Direction24,998 / 23,613 / - [in whole cluster]
24,998 / 23,613 / - [in contig]
Locationcomplement(23613..24998) [in whole cluster]
complement(23613..24998) [in contig]
TypeCDS
Length1,386 bp (461 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative glyceraldehyde-3-phosphate dehydrogenase
Product (GenBank)glyceraldehyde-3-phosphate dehydrogenase homolog
Gene
Gene (GenBank)gapX
EC number1.2.1.-
Keyword
Note
Note (GenBank)
  • GapX; probably not the G3PDH isoform used in primary metabolism
Reference
ACC
Related Reference
ACC
Q2XUQ9
PmId
[17600063] Expression of Corynebacterium glutamicum glycolytic genes varies with carbon source and growth phase. (Microbiology. , 2007)
[15925900] Corynebacterium glutamicum glyceraldehyde-3-phosphate dehydrogenase isoforms with opposite, ATP-dependent regulation. (J Mol Microbiol Biotechnol. , 2004)

close this sectionSequence

selected fasta
>putative glyceraldehyde-3-phosphate dehydrogenase [glyceraldehyde-3-phosphate dehydrogenase homolog]
MIPVIGRLQRQRDVTVLLHSRSLVNKSVVGILKTHRFARQIAGEELSVTETMPFLQALTT
LDLGPSQIDIGMLAETYKSDDRGLGVAEFTARPVEGATGERKIERAAPRDVVLYGFGRIG
RLLARLLIEKAGSGNGLRLRAVVVRKTAGQDLVKRASLLRRDSVHGQFQGTIIVDEENDT
LIANGNAIRFIYSDDPATVDYTAYGINDAILVDNTGRWRDRAGLSQHLRPGVAKVVLTAP
GKGDVPNIVHGVNHETIKPDERIISCASCTTNAIVPPLKAMADEFGVESGHVETVHSFTN
DQNLLDNYHKSDRRGRSAPLNMVLTETGAASAVAKALPDLGAKISGSSIRVPVPDVSIAI
LNLRLSRGTSREEVLTHLREVSLTSPLRRQIDFTTSADAVSSDFVGSRHASIVDAGATKV
DGDNAILYLWYDNEFGYSCQVVRVVQHVSGVEYPTFPAPLG
selected fasta
>putative glyceraldehyde-3-phosphate dehydrogenase [glyceraldehyde-3-phosphate dehydrogenase homolog]
ATGATCCCCGTCATCGGCAGGCTCCAGCGGCAACGGGACGTCACCGTGCTGCTGCACAGC
CGCTCGCTGGTGAACAAGTCGGTGGTCGGGATTCTCAAGACCCACCGATTCGCCCGGCAG
ATCGCGGGCGAGGAGCTGTCGGTCACCGAGACCATGCCGTTCCTCCAGGCGCTCACGACG
CTCGACCTCGGCCCCTCCCAGATCGACATCGGCATGCTCGCCGAGACCTACAAGAGCGAC
GACCGGGGCCTGGGCGTCGCCGAGTTCACCGCGCGGCCCGTCGAGGGCGCGACCGGCGAG
CGGAAGATCGAGCGCGCCGCCCCGCGCGACGTCGTCCTCTACGGCTTCGGGCGGATCGGG
CGGCTCCTCGCCCGGCTGCTCATCGAGAAGGCCGGCTCGGGCAACGGCCTGCGTCTGCGC
GCCGTCGTGGTCCGCAAGACCGCCGGTCAGGACCTCGTCAAGCGCGCCTCACTGCTGCGC
CGCGACTCCGTGCACGGCCAGTTCCAGGGCACGATCATCGTGGACGAGGAGAACGACACC
CTCATCGCGAACGGCAACGCGATCCGGTTCATCTACTCCGACGACCCGGCGACCGTGGAC
TACACCGCCTACGGCATCAACGACGCGATCCTCGTCGACAACACGGGCCGCTGGCGCGAC
CGCGCGGGCCTCTCGCAGCATCTGCGCCCGGGTGTCGCGAAGGTCGTCCTCACCGCGCCC
GGCAAGGGCGACGTGCCGAACATCGTGCACGGCGTGAACCACGAGACGATCAAGCCGGAC
GAGCGGATCATCTCCTGCGCCTCCTGCACGACGAACGCCATCGTGCCGCCGCTCAAGGCG
ATGGCCGACGAGTTCGGCGTCGAGAGCGGCCACGTCGAGACGGTGCACTCCTTCACCAAC
GACCAGAACCTGCTGGACAATTACCACAAGTCCGACCGGCGAGGGCGGTCCGCGCCGCTC
AACATGGTCCTCACCGAGACGGGTGCCGCCTCGGCCGTCGCGAAGGCTCTGCCGGACCTC
GGGGCGAAGATCAGCGGCAGCTCGATCCGCGTTCCCGTCCCCGATGTGTCGATCGCGATC
CTGAACCTCCGGCTGAGCCGCGGGACGAGCCGCGAGGAGGTCCTCACCCACCTGCGCGAG
GTCTCCCTCACCTCGCCGCTGCGCCGCCAGATCGACTTCACCACCTCCGCCGACGCCGTC
TCCAGCGACTTCGTCGGCTCGCGCCACGCCTCGATCGTGGACGCCGGGGCGACCAAGGTC
GACGGCGACAACGCGATCCTCTACCTCTGGTACGACAACGAGTTCGGCTACTCGTGCCAG
GTCGTACGGGTCGTCCAGCACGTCTCGGGCGTCGAGTACCCGACCTTCCCCGCACCGCTC
GGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006424 Glyceraldehyde-3-phosphate dehydrogenase, type I (Family)
 [111-443]  7.40000000000007e-111 TIGR01534
TIGR01534   GAPDH-I
IPR016040 NAD(P)-binding domain (Domain)
 [110-277]  4.30000000000003e-51 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020828 Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain (Domain)
 [109-269]  7.40000780398343e-55 SM00846
SM00846   Gp_dh_N
 [110-269]  2.99999999999998e-38 PF00044
PF00044   Gp_dh_N
IPR020829 Glyceraldehyde 3-phosphate dehydrogenase, catalytic domain (Domain)
 [274-431]  7.5e-45 PF02800
PF02800   Gp_dh_C
IPR020830 Glyceraldehyde 3-phosphate dehydrogenase, active site (Active_site)
 [267-274]  PS00071
PS00071   GAPDH
IPR020831 Glyceraldehyde/Erythrose phosphate dehydrogenase family (Family)
 [227-240]  7.60000011115812e-19 PR00078 [263-281]  7.60000011115812e-19 PR00078 [290-306]  7.60000011115812e-19 PR00078 [346-363]  7.60000011115812e-19 PR00078
PR00078   G3PDHDRGNASE
SignalP No significant hit
TMHMM No significant hit
Fren_00210 Fren_00210   last last