close all open/close all

CDS information : Gelda2_00010


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction11,984 / 11,301 / - [in whole cluster]
684 / 1 / - [in contig]
Locationcomplement(11301..11984) [in whole cluster]
complement(1..684) [in contig]
TypeCDS
Length684 bp (227 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative amino acid exporter
Product (GenBank)similar to predicted RhtB family transporters
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF16
Reference
ACC
PmId
[12586396] Cloning and characterization of a gene cluster for geldanamycin production in Streptomyces hygroscopicus NRRL 3602. (FEMS Microbiol Lett. , 2003)
Related Reference
ACC
C6GYU4
NITE
Pimar_00010
PmId
[19505319] PimT, an amino acid exporter controls polyene production via secretion of the quorum sensing pimaricin-inducer PI-factor in Streptomyces natalensis. (Microb Cell Fact. , 2009)

close this sectionSequence

selected fasta
>putative amino acid exporter [similar to predicted RhtB family transporters]
MSPGRSDSGGGGHVVSTESVLTFAAMSLLVIVIPGPSVLFVVGRALAHGRRTALATVLGN
VIGCYALVIAVAWGLGALVESSVALFMGVKLAGAAYLVYLGVQAFRHRREMRVANMDAPA
DERRGDLRSILDGILVGVTNPKGIVFFAAVLPQFVDHSVGHVPVQMMVLGLVPITIGLVT
DTLWGLGASAARSWFARSDRRLSMVGGAGGLAMIGLGVTVAATGRAD
selected fasta
>putative amino acid exporter [similar to predicted RhtB family transporters]
ATGTCCCCTGGACGGAGCGATTCAGGAGGTGGCGGACACGTGGTGTCCACGGAGAGTGTT
CTCACGTTCGCGGCGATGTCGCTCTTGGTGATCGTGATCCCGGGGCCGAGTGTGCTGTTC
GTGGTCGGCAGGGCCCTCGCACACGGCCGCCGCACGGCGCTCGCGACGGTCCTCGGCAAT
GTGATCGGCTGCTACGCCCTGGTGATCGCCGTGGCCTGGGGCCTCGGCGCGCTGGTGGAG
AGCTCGGTGGCGCTGTTCATGGGCGTGAAGCTGGCGGGAGCGGCGTATCTCGTCTACCTG
GGTGTGCAGGCGTTCCGGCACCGCAGGGAGATGCGCGTGGCGAACATGGACGCTCCGGCC
GATGAGCGGCGTGGTGATCTGCGTTCGATTCTGGACGGCATTTTGGTGGGCGTCACCAAC
CCGAAGGGCATCGTCTTCTTCGCGGCGGTGCTACCGCAGTTCGTCGACCACTCGGTGGGT
CATGTTCCCGTCCAGATGATGGTGTTGGGCCTGGTCCCGATCACCATCGGCCTGGTCACG
GACACCCTGTGGGGCCTGGGCGCCTCGGCGGCCCGCTCCTGGTTCGCCCGCTCGGACCGC
CGCCTTTCGATGGTCGGCGGGGCGGGCGGCCTCGCGATGATCGGCCTGGGCGTGACGGTG
GCGGCGACTGGCCGGGCCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001123 Lysine-type exporter protein (LYSE/YGGA) (Family)
 [29-221]  1.9e-28 PF01810
PF01810   LysE
SignalP No significant hit
TMHMM
 [20-42]  Transmembrane (o-i) [54-73]  Transmembrane (i-o) [83-105]  Transmembrane (o-i) [130-152]  Transmembrane (i-o) [167-189]  Transmembrane (o-i) [202-224]  Transmembrane (i-o)
Transmembrane 6