close all open/close all

CDS information : Gelda2_00020


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction12,973 / 12,071 / - [in whole cluster]
1,673 / 771 / - [in contig]
Locationcomplement(12071..12973) [in whole cluster]
complement(771..1673) [in contig]
TypeCDS
Length903 bp (300 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative secreted protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • similar to S. coelicolor SC3C8.01 (SC6382); ORF17
Reference
ACC
PmId
[12586396] Cloning and characterization of a gene cluster for geldanamycin production in Streptomyces hygroscopicus NRRL 3602. (FEMS Microbiol Lett. , 2003)

close this sectionSequence

selected fasta
>hypothetical protein [putative secreted protein]
MDKRTMGRHRRITQPPRTTLATRAVLAAGVLVPTIASAGSAHAATPQAAICTSDRPELAD
KLSEDINSALEGSAATTAISLHDRTTNTTCTLDADRHFDSASTVKVTVLSTLLWDAQKDN
RALTQEEKDHATAMITESDNDATTALWKQLGADKINGFLQAAGMTNTTLDSEGHWGLTQI
TANDEEKLLQLVTHTNPVLSDDSRAYILKLTAEVIPSQRWGTPAGAPSDAQVHVKNGWLE
RATNGWRVHSLGAFTGGDHDYTITVLSQDNATMDDGIANIEGIARAVHENLNAPVSSAQS
selected fasta
>hypothetical protein [putative secreted protein]
ATGGACAAGCGCACCATGGGTCGACACCGACGAATAACCCAGCCTCCCCGTACCACCCTG
GCGACAAGAGCGGTGCTGGCCGCCGGGGTGCTCGTGCCGACGATCGCCTCGGCGGGGTCG
GCTCACGCGGCCACCCCGCAGGCGGCGATCTGCACCTCGGACCGGCCGGAACTCGCCGAC
AAGCTCTCCGAGGACATCAATTCGGCGCTGGAGGGCTCCGCCGCCACCACGGCGATCAGC
CTCCACGACCGCACCACGAACACCACCTGCACTCTGGATGCGGACCGGCACTTCGACTCC
GCGAGCACGGTCAAGGTGACCGTGCTCAGCACCCTGCTGTGGGACGCGCAGAAGGACAAT
CGCGCCCTGACACAGGAGGAGAAGGACCATGCCACCGCCATGATCACAGAGTCCGACAAC
GACGCCACCACCGCGCTGTGGAAGCAGCTCGGGGCGGACAAGATCAACGGGTTCCTGCAG
GCCGCGGGAATGACCAACACCACCCTCGACAGCGAGGGCCACTGGGGGCTCACCCAGATC
ACCGCGAACGATGAGGAAAAGCTCCTCCAACTGGTGACCCACACCAACCCGGTGCTCAGC
GATGACTCCCGCGCCTACATCCTGAAGCTGACGGCCGAGGTCATCCCCTCGCAGCGCTGG
GGCACCCCGGCCGGCGCGCCGAGCGACGCCCAGGTGCATGTGAAGAACGGCTGGCTGGAG
CGGGCCACGAACGGCTGGCGGGTGCACAGCCTCGGCGCCTTCACCGGCGGCGACCACGAC
TACACGATCACGGTGCTCTCGCAGGACAACGCCACGATGGACGACGGCATCGCCAACATC
GAGGGCATCGCCCGCGCGGTCCACGAGAACCTCAACGCGCCCGTGTCCAGCGCTCAGTCG
TAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR012338 Beta-lactamase/transpeptidase-like (Domain)
 [61-125]  1.6e-23 G3DSA:3.40.710.10 [129-291]  3.60000000000001e-25 G3DSA:3.40.710.10
G3DSA:3.40.710.10   G3DSA:3.40.710.10
 [60-294]  2.39999798157265e-37 SSF56601
SSF56601   PBP_transp_fold
SignalP
 [1-43]  0.751 Signal
Bacteria, Gram-negative   
 [1-43]  0.746 Signal
Bacteria, Gram-positive   
TMHMM
 [20-42]  Transmembrane (i-o)
Transmembrane 1