close all open/close all

CDS information : Gelda2_00030


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction14,036 / 13,245 / - [in whole cluster]
2,736 / 1,945 / - [in contig]
Locationcomplement(13245..14036) [in whole cluster]
complement(1945..2736) [in contig]
TypeCDS
Length792 bp (263 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative hydrolase
Product (GenBank)putative hydrolase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • similar to S. coelicolor SCF1.09 (SC0267); ORF18
Reference
ACC
PmId
[12586396] Cloning and characterization of a gene cluster for geldanamycin production in Streptomyces hygroscopicus NRRL 3602. (FEMS Microbiol Lett. , 2003)
Related Reference
ACC
Q83WC8
PmId
[12542698] Role of Acinetobacter calcoaceticus 3,4-dihydrocoumarin hydrolase in oxidative stress defence against peroxoacids. (Eur J Biochem. , 2003)

close this sectionSequence

selected fasta
>putative hydrolase [putative hydrolase]
MTTRVPVAGGSLDVRVGGDMGPTLVFAHYWGGSADTWNGVIGHLPPGQATVRFDQRGWGT
SRALPGPYHLDQLADDLVRVIEERVSGPFVLVGHSMGGKAGQLVAARRPAGLVGLVLVAP
APPQPPAMVTEEYRQGLSHAYDSAETVGHALDHVLTATPLPEAVRATAERDSLAAGAEAR
QEWPLRGIARDITDAARRIEVPVTVLAAENDVVEPPHILREHLLPHIPHATLTTVPDAGH
LLPAEAPGAVARALGDFLTAIQS
selected fasta
>putative hydrolase [putative hydrolase]
ATGACAACGAGAGTTCCCGTGGCGGGCGGGTCGCTCGACGTGCGAGTCGGGGGCGATATG
GGCCCGACGCTGGTGTTCGCCCACTACTGGGGCGGCTCCGCCGACACCTGGAACGGTGTG
ATCGGCCACCTGCCGCCCGGGCAGGCGACGGTCCGCTTCGACCAGCGCGGCTGGGGCACC
TCGCGGGCGCTGCCCGGCCCCTATCACCTCGACCAGCTCGCCGACGATCTCGTCCGTGTG
ATCGAGGAGCGCGTGTCGGGGCCGTTCGTCCTCGTCGGCCACTCGATGGGCGGCAAGGCG
GGCCAGCTCGTCGCGGCCCGCCGACCGGCCGGCCTGGTCGGCCTGGTGCTCGTCGCGCCC
GCGCCGCCCCAGCCGCCCGCCATGGTGACCGAGGAATACCGGCAGGGCCTGTCACACGCC
TATGACTCGGCCGAGACGGTGGGGCACGCCCTCGACCACGTCCTGACCGCCACACCGCTG
CCCGAGGCAGTGCGGGCCACCGCGGAGCGCGACAGCCTCGCCGCCGGTGCCGAGGCCCGG
CAGGAGTGGCCCCTGCGTGGAATCGCGCGGGACATCACCGATGCCGCACGGCGTATCGAG
GTCCCGGTGACGGTGCTGGCCGCGGAGAACGACGTGGTTGAGCCGCCGCACATCTTGCGC
GAACACCTCTTGCCCCACATCCCGCACGCGACCCTGACGACTGTCCCGGACGCCGGCCAC
CTGCTCCCCGCGGAAGCCCCCGGCGCCGTCGCGCGAGCCCTCGGAGACTTCCTCACGGCC
ATTCAGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit