close all open/close all

CDS information : Gelda2_00040


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction14,190 / 15,074 / + [in whole cluster]
2,890 / 3,774 / + [in contig]
Location14190..15074 [in whole cluster]
2890..3774 [in contig]
TypeCDS
Length885 bp (294 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative AraC family transcriptional regulator
Product (GenBank)putative transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • AraC family; similar to S. coelicolor SC5A7.14 (SC6644) and SCF1.08c (SC0266); ORF19
Reference
ACC
PmId
[12586396] Cloning and characterization of a gene cluster for geldanamycin production in Streptomyces hygroscopicus NRRL 3602. (FEMS Microbiol Lett. , 2003)
Family/Domain
FD
IPR018060

close this sectionSequence

selected fasta
>putative AraC family transcriptional regulator [putative transcriptional regulator]
MENGHSAVRQLRYLPAVGSAYGVEVLDFAALRSMDTQRRRTQPQRPDFHVFALVGSGTGS
HEADFHNYRLGEGGAVWIRPGMVHRWSDIDACDGPLILFRPGFLSGFTASEATAPACWHL
DRQRLSLALLAAEHLGREHSTAVHTPRLASPVLLSHLLAALILRALPGTPPSVGPASPGS
RPTEVFRAYRAAVEERFTDWHHVADYARALGYDVRTLTRTTRAATGTGAKTFLDQRILLE
AKRLLAHTDLPVSGCARRLGFRDVGNFTTFFRRQAGLPPAAWRAAYSTAGAQGG
selected fasta
>putative AraC family transcriptional regulator [putative transcriptional regulator]
GTGGAAAACGGACACAGTGCGGTGCGGCAACTGCGCTACCTGCCTGCCGTGGGATCGGCG
TACGGGGTGGAGGTCCTCGATTTCGCGGCGCTGCGTTCGATGGACACCCAGCGCCGTCGT
ACCCAGCCGCAGCGCCCCGACTTCCATGTGTTCGCGCTGGTCGGTTCCGGAACCGGCAGC
CACGAAGCGGACTTCCACAACTACCGGCTGGGGGAAGGCGGCGCCGTGTGGATCCGGCCG
GGCATGGTGCACCGCTGGAGCGATATCGACGCCTGCGACGGCCCGCTGATCCTCTTCCGG
CCCGGCTTCCTTTCCGGCTTCACAGCGTCGGAGGCCACCGCGCCGGCGTGCTGGCACCTG
GACCGGCAGCGCCTGTCCCTCGCCCTGCTCGCGGCCGAACATCTCGGCCGCGAGCACAGC
ACGGCAGTGCACACACCACGCCTGGCATCCCCCGTCCTGCTGTCCCACCTGCTGGCGGCA
CTGATCCTGCGCGCACTCCCCGGCACACCGCCCTCAGTCGGCCCGGCAAGCCCCGGCAGC
CGACCTACCGAAGTGTTCCGCGCCTATCGGGCCGCCGTCGAAGAGCGCTTCACCGACTGG
CACCATGTGGCCGACTACGCGCGGGCATTGGGCTACGACGTACGCACCCTCACCCGGACA
ACGCGTGCCGCCACTGGCACGGGCGCCAAGACATTCCTCGACCAGCGCATCCTGCTGGAG
GCGAAACGGCTGCTCGCCCACACCGACCTGCCGGTCAGCGGCTGCGCCCGACGCCTCGGC
TTCCGGGACGTCGGCAACTTCACCACATTCTTCCGTCGCCAGGCCGGCCTGCCCCCCGCC
GCGTGGCGCGCCGCATACAGCACCGCAGGCGCACAAGGCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003313 Transcription regulator HTH, AraC, arabinose-binding/dimerisation (Domain)
 [29-126]  1.5e-08 PF02311
PF02311   AraC_binding
IPR009057 Homeodomain-like (Domain)
 [236-286]  2.79999889404114e-10 SSF46689
SSF46689   Homeodomain_like
 [238-285]  1.2e-11 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
IPR011051 RmlC-like cupin domain (Domain)
 [41-102]  2.10000037262656e-07 SSF51182
SSF51182   RmlC_like_cupin
IPR018060 DNA binding HTH domain, AraC-type (Domain)
 [187-285]  PS01124
PS01124   HTH_ARAC_FAMILY_2
 [199-283]  2.10000267834031e-20 SM00342
SM00342   HTH_ARAC
SignalP No significant hit
TMHMM No significant hit