close all open/close all

CDS information : Gelda2_00050


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction15,885 / 15,124 / - [in whole cluster]
4,585 / 3,824 / - [in contig]
Locationcomplement(15124..15885) [in whole cluster]
complement(3824..4585) [in contig]
TypeCDS
Length762 bp (253 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)putative transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • TetR family; similar to S. coelicolor 2SCD46.08 (SC4194); ORF20
Reference
ACC
PmId
[12586396] Cloning and characterization of a gene cluster for geldanamycin production in Streptomyces hygroscopicus NRRL 3602. (FEMS Microbiol Lett. , 2003)
Related Reference
ACC
Q8KUE8
NITE
Ansam_00020
PmId
[19609582] Constitutive overexpression of asm2 and asm39 increases AP-3 production in the actinomycete Actinosynnema pretiosum. (J Ind Microbiol Biotechnol. , 2009)
ACC
P39885
PmId
[1592820] The Streptomyces glaucescens TcmR protein represses transcription of the divergently oriented tcmR and tcmA genes by binding to an intergenic operator region. (J Bacteriol. , 1992)

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [putative transcriptional regulator]
MLSVNTVTPSHLNAPTRLTRGKYIPGAEIYQGQFSATVDAVDGKPGLRERKKQRTHAAIS
DAAISLFLEYGFNQVSVAQVAEAAEVSKRTLFAYFPTKEDLVVHRLADHETESARVVRAR
PPRTAPLTALREHFLEGLRERDPITGLNDQPEVRRLHRMILDAPSLVARMAGFKTGAERA
LTEALRETADTPELTARLAAVQIVAVHWALAQDNAERLAYGEPADERYAGAVADMEHAFA
LLENGLRHLPPRQ
selected fasta
>putative TetR family transcriptional regulator [putative transcriptional regulator]
GTGCTCTCCGTCAACACCGTCACTCCATCTCATCTCAACGCTCCGACTCGGCTCACTCGG
GGTAAATATATACCCGGTGCAGAAATTTACCAGGGGCAGTTTTCTGCTACCGTGGACGCC
GTGGACGGCAAGCCAGGGCTACGGGAACGAAAGAAGCAGCGGACCCACGCGGCGATCTCC
GACGCGGCGATCTCGCTGTTTCTCGAATACGGCTTCAACCAGGTCTCGGTGGCCCAGGTG
GCCGAGGCGGCCGAGGTGTCCAAGCGCACCCTCTTCGCCTACTTCCCGACGAAGGAAGAC
CTCGTGGTGCACCGCCTGGCCGACCACGAGACCGAATCCGCACGCGTCGTGCGGGCCCGC
CCGCCCCGTACCGCCCCGCTGACCGCACTGCGCGAGCACTTCCTCGAGGGGCTGCGCGAG
CGGGATCCGATCACCGGGCTGAACGACCAGCCCGAAGTGCGCAGGCTCCACCGCATGATC
CTCGACGCGCCCTCGCTGGTGGCCCGGATGGCAGGGTTCAAGACCGGCGCCGAGCGCGCA
CTGACTGAGGCACTGCGGGAAACGGCGGACACTCCGGAACTCACCGCGCGGCTCGCCGCC
GTCCAAATCGTCGCGGTCCACTGGGCGTTGGCGCAGGACAACGCCGAACGCCTGGCGTAC
GGGGAGCCGGCCGACGAGCGCTATGCGGGTGCGGTGGCCGACATGGAACACGCCTTCGCC
CTGCTGGAGAACGGATTGCGGCACCTGCCCCCGCGACAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [60-102]  2e-14 PF00440
PF00440   TetR_N
 [53-113]  PS50977
PS50977   HTH_TETR_2
 [59-72]  2.79999889404114e-08 PR00455 [80-103]  2.79999889404114e-08 PR00455
PR00455   HTHTETR
IPR009057 Homeodomain-like (Domain)
 [48-123]  7.10001443313147e-17 SSF46689
SSF46689   Homeodomain_like
 [47-100]  3.90000000000001e-20 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [101-246]  1.9e-12 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
IPR023772 DNA-binding HTH domain, TetR-type, conserved site (Conserved_site)
 [71-102]  PS01081
PS01081   HTH_TETR_1
SignalP No significant hit
TMHMM No significant hit