close all open/close all

CDS information : Gelda2_00060


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction15,869 / 17,365 / + [in whole cluster]
4,569 / 6,065 / + [in contig]
Location15869..17365 [in whole cluster]
4569..6065 [in contig]
TypeCDS
Length1,497 bp (498 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)GdmL
Gene
Gene (GenBank)gdmL
EC number
Keyword
Note
Note (GenBank)
  • putative FAD-dependent monooxygenase
Reference
ACC
PmId
[12586396] Cloning and characterization of a gene cluster for geldanamycin production in Streptomyces hygroscopicus NRRL 3602. (FEMS Microbiol Lett. , 2003)
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
PmId
[18600054] Characterization of tailoring genes involved in the modification of geldanamycin polyketide in Streptomyces hygroscopicus JCM4427. (J Microbiol Biotechnol. , 2008)
ACC
Q58PK7
PmId
[16148009] Ablation of the otcC gene encoding a post-polyketide hydroxylase from the oxytetracyline biosynthetic pathway in Streptomyces rimosus results in novel polyketides with altered chain length. (J Biol Chem. , 2005)

close this sectionSequence

selected fasta
>putative oxidoreductase [GdmL]
MLTESTTEVVVAGAGATGLMLAYELALAGVETLVLEKLPQRIQQVKGGTIQPRTAELLES
RGLLEPMLRRAIARDPVGGSFGALPVPLDCAPWRTEHPFPIGIPQWEIEEVLEERATAAG
ARVLRGTAVSGVAPDDDGVVVTADGLRARAHYLVACDGGHSTVRKLLGLPFPGRAGTHPA
VLADIRLSAVSSLVPRQMGLMSTMTRHARGYWSMLVPLGGDRYRFTFGHADQADTARDTP
VTHEEIAAALQAVYGPETTLGAVDNSSRFSDATRQLEHYRTGRVLFAGDAAHIHPPLGAQ
GLNLGVQDALNLGWKLAAVLQDRAPNGLLDSYHAERHPVAAQVLHHTSAQRVLAISNPSE
DVAALRDIFTDLLRLPDTNRHLAGLMSGLSLRYDLPGDHPLTGERIPDADLVTETGTTRL
STLFGSGHAVLLDLAGAVPADLPLPPRVDLVRATCADDMGAAALLIRPDGYVCWATDTSA
ACGDTLLAALTGDLARVP
selected fasta
>putative oxidoreductase [GdmL]
GTGTTGACGGAGAGCACGACCGAGGTCGTTGTCGCGGGTGCGGGCGCGACCGGACTGATG
CTGGCGTACGAACTGGCTCTGGCCGGGGTCGAGACCCTGGTGCTGGAGAAGCTGCCCCAG
CGGATCCAGCAGGTGAAGGGCGGCACGATTCAGCCCCGTACCGCCGAACTGCTGGAGTCC
CGCGGCCTGCTGGAGCCGATGCTGCGGCGGGCCATTGCGCGTGATCCGGTGGGCGGCAGT
TTCGGGGCCCTGCCCGTGCCCTTGGACTGCGCCCCCTGGCGGACCGAGCACCCCTTCCCG
ATCGGGATCCCTCAGTGGGAGATCGAGGAGGTGCTCGAGGAGCGGGCGACCGCCGCCGGA
GCGCGGGTGCTGCGCGGCACCGCCGTCTCAGGGGTCGCGCCGGACGACGACGGTGTGGTC
GTCACGGCGGACGGCCTGCGGGCGCGGGCTCACTATCTGGTGGCGTGCGACGGCGGCCAC
AGTACGGTGCGCAAACTGCTCGGGCTGCCGTTTCCCGGCAGGGCCGGAACGCATCCGGCG
GTGCTGGCCGATATCCGTCTGTCCGCCGTATCCTCACTGGTGCCGCGGCAGATGGGACTT
ATGAGCACCATGACCCGTCATGCGCGCGGCTACTGGTCCATGCTGGTCCCTCTCGGCGGC
GACCGGTACCGGTTCACCTTCGGGCACGCGGACCAGGCGGACACCGCCCGCGACACCCCC
GTCACCCACGAGGAGATCGCGGCCGCGCTGCAGGCCGTGTACGGCCCTGAGACCACCCTC
GGCGCCGTGGACAACTCCTCGCGGTTCTCCGACGCCACGCGACAACTGGAGCACTACCGC
ACGGGCCGTGTCCTGTTCGCCGGGGACGCCGCGCATATCCACCCCCCGCTGGGCGCCCAG
GGCCTCAACCTCGGCGTACAGGACGCGCTCAACCTCGGGTGGAAACTGGCCGCGGTCCTC
CAGGACCGGGCGCCGAACGGCTTGCTGGACAGCTACCACGCCGAACGGCATCCGGTCGCG
GCCCAGGTCCTGCATCACACCTCGGCGCAACGCGTCCTGGCGATTTCGAACCCGAGCGAG
GACGTGGCCGCCCTGCGCGACATCTTCACCGACCTGCTGCGGCTGCCCGACACCAACCGC
CATCTCGCGGGGCTGATGTCCGGCCTCTCGCTGCGCTACGACCTGCCCGGCGATCACCCG
CTCACCGGAGAGCGCATCCCGGACGCCGATCTGGTGACCGAAACCGGCACCACCCGGCTG
TCGACGCTCTTCGGCTCCGGACACGCCGTCCTGCTCGACCTGGCCGGAGCCGTCCCGGCC
GACCTCCCGCTCCCGCCACGAGTCGACCTCGTCCGCGCCACATGCGCCGACGACATGGGC
GCCGCCGCCCTGCTCATCCGTCCCGACGGCTATGTCTGCTGGGCTACGGACACCTCCGCC
GCCTGCGGCGACACCCTGCTGGCCGCGCTCACCGGCGACCTCGCGAGGGTGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [7-345]  1.10000000000001e-81 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [8-30]  6.39998633403535e-43 PR00420 [149-164]  6.39998633403535e-43 PR00420 [281-296]  6.39998633403535e-43 PR00420 [296-312]  6.39998633403535e-43 PR00420 [314-332]  6.39998633403535e-43 PR00420 [332-348]  6.39998633403535e-43 PR00420
PR00420   RNGMNOXGNASE
SignalP No significant hit
TMHMM No significant hit