close all open/close all

CDS information : Gelda2_00070


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction17,877 / 17,407 / - [in whole cluster]
6,577 / 6,107 / - [in contig]
Locationcomplement(17407..17877) [in whole cluster]
complement(6107..6577) [in contig]
TypeCDS
Length471 bp (156 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)GdmX
Gene
Gene (GenBank)gdmX
EC number
Keyword
Note
Note (GenBank)
  • similar to JadX and MmyY
Reference
ACC
PmId
[12586396] Cloning and characterization of a gene cluster for geldanamycin production in Streptomyces hygroscopicus NRRL 3602. (FEMS Microbiol Lett. , 2003)

close this sectionSequence

selected fasta
>hypothetical protein [GdmX]
MTATADYDSLARRLRALEDKEALRALMIRGWRALDRKDWQTWIECWAEDAVLEFGPWEKI
HGKEAVRAKVEEVESPYASMQHHILNMHVDVEGDRATGIGYMWFVAVTAPGSTSSPYSMG
GPYDWEFRRGPDGWLLVRQRLGVWWTDGEDTLRAFA
selected fasta
>hypothetical protein [GdmX]
ATGACAGCGACAGCCGACTACGACAGCCTGGCCCGCCGGCTGCGCGCCCTGGAGGACAAG
GAAGCCCTGCGCGCCCTCATGATCCGCGGATGGCGTGCGCTGGACCGCAAGGACTGGCAG
ACCTGGATCGAATGCTGGGCCGAGGACGCGGTGCTGGAGTTCGGGCCGTGGGAGAAGATC
CACGGAAAAGAGGCGGTCCGGGCCAAGGTGGAGGAGGTGGAATCACCGTACGCGAGCATG
CAGCATCACATCCTCAACATGCACGTCGACGTGGAGGGCGACCGGGCGACGGGGATCGGC
TACATGTGGTTCGTGGCCGTCACCGCACCCGGGAGCACCTCCTCTCCCTACTCCATGGGC
GGCCCCTACGACTGGGAATTCCGCCGGGGCCCGGACGGCTGGCTCCTGGTCCGCCAACGG
CTCGGCGTCTGGTGGACCGACGGCGAGGACACCCTGAGGGCCTTCGCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit