close all open/close all

CDS information : Gelda2_00080


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction18,508 / 39,036 / + [in whole cluster]
7,208 / 27,736 / + [in contig]
Location18508..39036 [in whole cluster]
7208..27736 [in contig]
TypeCDS
Length20,529 bp (6,842 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)GdmAI
GenegdmAI
gdmA1
Gene (GenBank)gdmAI
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase; modules 0-3
Reference
ACC
PmId
[12586396] Cloning and characterization of a gene cluster for geldanamycin production in Streptomyces hygroscopicus NRRL 3602. (FEMS Microbiol Lett. , 2003)
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
[16927319] Determination of the cryptic stereochemistry of the first PKS chain-extension step in ansamitocin biosynthesis by Actinosynnema pretiosum. (Chembiochem. , 2006)
Related Reference
ACC
Q49BE1
NITE
Herb_00170
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)

close this sectionPKS/NRPS Module

0
1 methylmalonyl-CoA
2 methoxymalonyl-ACP
3 methylmalonyl-CoA
A36..442
PCP1012..1082
KS1102..1478
AT1642..1960
DH2009..2175
ER2486..2786
KR2796..2976
ACP3073..3147
KS3169..3543
AT3713..4034
DH4082..4242
ER4552..4850
KR4860..5040
ACP5143..5213
KS5242..5617
AT5780..6099
KR6405..6585
ACP6684..6757

close this sectionSequence

selected fasta
>polyketide synthase [GdmAI]
MLRTDLIRPVPELLRANADRFGDKPACSDGHRTVSHAELERRTRRLAGHLAGLRLHPGDR
AMICLGNRVEMVESYFGVLRANGVAVPVNPRSTDAELSYLLADSGARLVLTDVAHADQFG
RLREQFPELRVVVSGDGPLPKGFIAFEPLPDTEPQLAARDDLGLDEITWMLYTSGTTGLP
KGVLSTQRNCLWSLAACYVPVTGLTAEDRVLWPLPLFHSLSHIVCLLAATAVGASTRIVD
GVSTADVLDALREERSTFIAGVPTLYHHLIEAARERDFATPELRIALVGGAVATADLVRS
FESAFGVPLVDAYGSTETCGAIAVNWPTGPRVEGSCGLPVPGLTVRLVDPDTGVDVPAGR
EGEFWVSGPNIMAGYHNQPEATASALRDGWYRTGDLGRRDEAGFCTVTGRIKELVIRAGE
NIHPGEVEAVLRTVPGVADAAVVGKPHAVLGEVPVAFVVPGPDGFDPSALLATCRERLSY
FKVPEEIYEIARVPRTASGKITRHVLLELPARLRAAGDGQYDSLLRLDWVPQSALPDAPA
GTGTWALADADALGLAVGLRAAGVDARVVGEPVGEPVADSVAGLVAGSVADLAGDDGAAP
DVVVVTPPVAGLPDETGAPDEAGVTVGERADRLAARLGAWLADDRLAGTTFVVATTGAVA
TGAEEDAPEPLSAALWGVVRSLQAAYPGRLTLVDVDLDGAGDRAGDGAGEDGREAALLRA
VQGGHDQAAIRGGVLLVPRLTRISFPAEPGPAPTLDAGGLVVITGGDTTRGTALARHLVT
AYGARNLLLLSANGLPEEAAATLRTELARDGAQVSMAVCDPADRTALDSVLDAQARPVTA
AVHIEEPSPERSLDTSLRAMTHLEERTRGAAPALFVVVTSAAGVLGSPGRPDRAAADQFG
EALVRRRRALGLGGLALAWGPLPGEHGTAPVAGAVPLPEALALFDAALTAGQGPLVLLRP
STTGLPGGEPVPAVLRHLVDAPSGVPASDEPAVAEFRRRLAAESESGRQRMALALVREHA
AATLGLASADPVEAGQAFSAFGFTSLTAVALRNRLNAATGARLAATVVFDHPTPAGLARH
LVREITGRRGVQAPVRARGVSDEPVAIVAMGCHLPGEVATPEDLWRLVADGRDAIAGFPE
DRGWDLAGLFDSDPDAVGKSYVREGGFLTDAGGFDAAFFGISPREALAMDPQQRLLLETA
WETFENAGIDPGSLHGTDVGVFSGVMYHDYGADAGTAAEGLEGHLGVGSAGSVVSGRVAY
ALGLTGPAVTVDTACSSSLVALHLAVQAVRTGECSLALAGGVAVMSRPTSFIEFSRQRGL
APDGRCKSFAEGADGTNWSEGVGLVLLERLSDARRNGHEVLAVVRGTAVNQDGASNGLTA
PNGPSQERVIRQALANAGLTVADVDAVEAHGTGTSLGDPIEAQALLATYGQERPEDQPLW
LGSLKSNIGHAQAAAGAAGVIKMVQAMRHGVLPKTLHADEPTSKVDWTSGAVSLLSEARP
WPETGHPRRAGISSFGVSGTNAHVVLEQAPLEAAAPETQASDAGAPGLVATGGVVPWVLS
AKTPAALRAQAERLVSHLESGSDANPVDVGWSLATTRAALEHRAVILATDAEGGMATARA
LAEGRPDPLLVTGQTGTDGKTVFIFPGQGAQWVGMGAQLLNTSPVFAARLRECADALAPY
TDWSLIDVITGTPDAPSLERVDVVQPATFAVVVSLAALWQSVGIHPDAVIGHSQGEIAAA
CVAGHLTLTNAAKIVTLRSQTIAHHLAGHGGMMSLATPADTIDLTNWHGKLWIAAHNSPN
ATVIAGDTDALHQLHTHYTDQGTRARIIPVDYASHTGHVDTIKNQLQDVLDGITLEPGTI
PWLSTVTGQWIEPNTVGDSYWYRNLRQTVQFEHTIHTLADQGYRTYIEISPHPVLTTAIQ
ETLEANDTPNTTIVTGTLRRDDDTPTRLLTNLAHLTTNGTPVNWPTLFTGTQPTRIPLPT
YPFQHHHYWLPRNTSAGDVSAVGLQGTGHPLAGAVVSVPDTGGVLLTGQLSVATHPWLAD
HAVSGTVLLPGTAMAELAIRAGDETDTPTLEELVIGQPMTLPEDGALHVQVLVGGVEDGR
RGVRIYSRPDAAQEQEWLEHASGTLATQPDGSAEGGMENGMPEWPPPGVEPIALDDFYDD
LAQAGYEYGPAFRGLKAVWKRDGEVFAEAALPEEQTDVAGRFGIHPALLDAALHASNFCV
PPAPGQTLLPFVWNGVRLLAAGATAVRVRARATGTDSFTISLFDSTGSPVASVDSLVLRA
ISPEQLAAASGGAGRSADALFTLDWTEHPTALGTEVSWATLGDAHTDVDAHVDALIAGED
RPGAVVADTAAWAAGDTGLPARARDLAARALDLVQRWVGRPELADVRLVLLTRGAVSVHD
TAEVTDPAAAAIWGLVRSAQSEHPGRIALVDTDDVSREALPEAVAAGEPQVALRRGLLWV
PRLVRSPQGLAVPAHEHWYLDVSEKGSLENLVLRPDPEATAPLATGQVRIEVRAAGQNFR
DVLVALGGVAGQEGLGGEGAGVVTEVGPGVEGLAVGDRVMGLFPRSFGPLAIADARTVAP
IPEGWSYATAAGVPVAYLTALYGLRDLGTVQPGETVLVHAAAGGVGMAAVQLARHFGATV
YATAHPSKHHVLTALGVPEGHLASSRDLGFASAFPALDVVLNSLTGEYVDASLGLLGTGG
RFVEMGKNDIRDPASVAAAHPGVGYQAFDLGGDAGPDRIRELLAELVELFEAGRIEPLPI
RHWDVTQAPTAFRWMSQGRHTGKIVLTLPRALDPDGTVLITGGTGTLGATIARHVVTHHG
ARQLLLISRQGPDAPGATDLTTELTELGATVRITACDTADRDQLAALLADIPAAHPLTAV
IHTAGALDDGVLTALTPDRLDTVFRPKVDAVTHLHDLTRDQDLAAFVIYSSAAGTLGNAG
QANYAAANAFLDAFAQWRHARHRPATSLAWGLWSDTSTLTSTMDATDVRRTRRAGVLGMD
NAEALRVFDTGLRSGRPALVAAKIDLTALRAPDAELSPLLRGLARPARRTARTAAPAAGG
LSGQLAGLSPAGQREFLLNLVRAEAAVVLAHAGPEAIEPTVAFKEMGFDSLTAVELRNRL
NAATGLRLPATLLFDHPTPALLTELFHTELGGGPAPAAAAPVTVRAAADEPIAVVAMSCR
LPGGVTDPDGLWNLLLEERDGIADFPRDRGWDLEALFDADPDRSGTSYVLRGGFLEDAAG
FDADFFGISPREALAMDPQQRLFLEACWEVFERAGMDPTTVGGGDIGVFAGVINQDYGVR
SGPAPEDLEGYMLTGSATSVASGRVAYVLGLEGPAVTVDTACSSSLVAMHWAVQALRQGE
CSMALAGGATVMGRPSAFVEFSRQRGLAPDGLCKAFGAGADGTTFSEGVGVLLLERLSDA
RRNGHEVLAVIRGTAVNQDGASNGLTAPNGPSQQRVIRQALANAGLSATDIDAVEAHGTG
TALGDPIEAQALLATYGQDRPGDEPVWLGSLKSNTGHTLAAAGVSSVIKMVLAMRHGTLP
RSLYADEPTPEVDWSQGAVSLLTEARPWPETSHPRRAGISSFGISGTNAHLILEQAPQSE
TEPEAAPKADGGMDTPGLVATGGSVPWVLSAKTPTALRAQAQRLLDHLESGVTDRPLDIG
WSLATTRTLHDHRAIILTDTEGGDATAALTALATGQPHPRLTTGHATTHGKTVFVFPGQG
AQWQGMGAQLLDTSPVFATRLHECADALAPYTDWNLIDVITGAPHAPSLDRVDVLQPTTF
AIMVSLAALWQANGIHPDAVIGHSQGEIAAAHIAGHLTLTDAAKIVALRSQTIAHHLTGH
GAMMSVLASHTWVQEALAPWHGHLWIAAVNGPASVSVSGDPDALAEFGVTLSKAKVYRWQ
LPGVDFAGHSGHVDTIKDQLHHVLDGVTASPGTVAWMSTVDADWANPTHIDAHYWYRNLR
DTVRFEEATRALLTHGHRVFIEISTHPVLTTAIQDTTETLPEVRATITGTLRRDDGGPDR
VLTSLAELSTAGIPVHWPTAYAGTTPSQVPLPTYPFQHQHYWLAATGHHGDVGSVGLRDA
AHPLLGAVVSVPDTGGVLLTGRLAPSAQSWLADHMLSGVALVPGTAIVELAVRAGDETGT
PVLEELVLGQPMLLPEDGSLQVQVLVGAAEDDERRAVRVYSRGDESEPWVEHASGILSAH
ALVPVEAERQWPPTGAEPVVLEGFYDRLAQAGYEYGPVFRGLTAAWTRGDDVFAEITLGE
DQHDLAGRFGIHPALLDAALHASNFCPGNEPGGGTYLPFSWNGVQLHADGATALRVRVTS
TGPDNLSLHATDPHGVPVVTVGSLVLRETTAEQLRTTSATSAADSQFTVEWTEHPLARDE
VAWAALEAVQDDDTWPPVVVADTRAFAAQGGGLPDEGGLQEDGELPERARELTGRALAAI
QRLISDDALADSRLTLLTRGGMAVHDDTEVTDPAAAAVWGLVRAAQAEHPGRVCVIDIDD
RSAEALTAALATEEPQLALRGGTAWVPRLVRARPGLAVPAAVAWHLDVTEHGTLENLALV
PHPRAEAPLEAGQVRIAVRAAGQNFRDVLIALGMYEAEIGTEGAGVVTEVGPGVADLTVG
DRVMGMLPGSFGPLVVADRRTVVRMPRGWSFTAAAGVPVAYLTALYALRDLGDVQPGETV
LVHAAAGGVGMAAVHLAHHFGATVLATAHPAKHHSLEQLGVPTERRASSRDLAYARTFPT
ADIVLNSLTGEHIDASLGLLAPGGRFIEMGRTDIRDVDEVRASHPDRTYRAFDLGADAGP
DRIQELLAELVDLFEQGLIPPLPTRPWEITRAPDAFRWMSQGRHTGKIVLTLPRIPDPEG
TVLITGGTGTLGTAITRHLVTHHGVRNLVLASRQGPNALGAADLHDELTALGAQVRITAC
DIADRGQLAALLADIPSDHPLTGIVHTAGALADGTLTTLDPDRIDTVFRPKVDAVTHLHD
LTRDQDLALFAVYSSAAGILGNAGQANYAAANTFLDAFVQRRRAAGLAGLSLAWGLWAET
SDLSAALITANRDRTQHGVVRPMATEHALSLFDSALGLGLSLVVPAKLDPGAHESAAGAV
PPLLTGLLRPTRRTLRSTAGQSGEGGLTARLAALSEADQHRLLLDLVRDHTATVLGHAGK
DAVDARRAFSEIGVDSLIAVELRNRLAGATGLRLPATVVFDYATPEAMAGHLRSVVAGDT
AAPASPSTSAVAPASAVAPADDPVAIVSMNCRLPGKVTGPGELWDLVSQGRDAIGPFPTD
RGWDVETLFDLDPDAVGKSYVREGGFLTGAGDFDAEFFGISPREALAMDPQQRLLAETSW
ELFERAGIDPVSVRGQAIGVFAGVIDQGYIAHSEAPPPELEGYLMTGSTTSVASGRVAYL
LGLEGPAVTVDTACSSSLVALHLAVQALRAGECSMAITGGVTVIAKPGGFISFSRQRGLA
PDGRSKSFSEGADGTSFSEGIGLVLLERLSDARRNGHEVLAVIRGTAVNQDGASNGLTAP
NGPSQQRVIRQALANAGLTVADVDAVEAHGTGTALGDPIEAQALLATYGQDRPGDEPLWL
GSLKSNIGHTQAAAGIAGLIKMVLAIRQGTLPRSLHAGEPTTKVDWTSGAVSLLSEARPW
PETGHPRRAGISSFGISGTNAHVILEQGPEVAVPATEARDAGAPGLVATGGVVPWALSAK
SPAALRAQAERLVSHLESGDAPRAVDVGWTLATTRAALEHRAVILATDTEDGIATARALA
EGRPDPLLVTGQTGTDGKTVFVFPGQGAQWVGMGAQLLNTSPVFAARLNECAEALAPYTD
WSLMDVITGAPGAPSLERVDVVQPATFAVVVSLAALWQSVGIHPDAVIGHSQGEIAAACV
AGHLTLTNAAKIVTLRSQTIAHHLAGHGGMMSVLASREQVEEALTPWHGKLWIAAHNSPN
ATVIAGDTDALHQLHTHYTDQGIRARVIPVDYASHTGHVDTIKNQLHQTLADTTTEPGTI
PWLSTVTGQWIEPDTVDSGYWYRNLRQTVQFHTAITALAHEGYRTFIEISPHPVLTTAIQ
ETLEANDTPNTTITGTLRRDDDTPTRFLTHLAHLTTHGHTPDWTALYSATHPRPTPLPTY
AFQHHHYWLTPSEVPEAVADGVFWDAVERGDLASLADSLGVEEKTLEPVLPGLTSWRRRN
QDQSTVDTWSYRIAWDPVATGEAPVLPGAWLVAVASPQASDAAVTDVVAALAAHGADPVV
VEVDTVEQAEVTARLRERISDSDDEYAGVVSLLAWDERSYEPGTLSRGVAATVALIQAVE
EIGLAAPLWCLTRGAVAVREPSEVTSEFQPLAWGMGVVQGLDQPSTWGGIVDLPRTPDET
ALVRLCSVLAGVDAEDQVAVRASGVFARRMRREPVTSAPAWQPRDTVLITGGTGGLGSYV
GRWAAGHGARRVVLLSRQGAQAPGAAELEAELSALGADVTIAACDVTDRDQLAAVLAEIP
DDAPLSGVVHAAGLALPEKPLSKMTLAEFADIGQAKIAGARHLDDLLGERELDAFVLFSS
GAAAWGSGGQSAYAAGNAYLDGLAQRRRARGLAATSVAWGAWGGGLGTIDEMMGAQWRRT
GLMTMDPRLAALAMAHTVGSGTAHGVVADIDWERFAPGYTMARFRPLLRGLPDVIDLLTE
DAPEDSAGQTELIARLAGLSPEDQERLLTELVQAEAAAVLGHVSADATGDRPFSEIGFDS
LTAVELRNRLNASTGLRLPATMVFDHPRPSVLARRIRTELGHTDTSSVDSVLAELERLEA
HLAALPKEKIERARITSRLQRMTTKVAEIEAVGTGGDTVTERLDTANADDVFAFIDQEFG
VD
selected fasta
>polyketide synthase [GdmAI]
ATGCTACGGACTGACCTGATCCGGCCGGTGCCCGAACTGCTCCGGGCCAACGCGGATCGC
TTCGGTGACAAGCCGGCCTGTTCCGACGGACACCGCACGGTCAGCCATGCCGAACTCGAA
CGCCGTACCCGGCGGCTGGCCGGTCATCTCGCCGGGCTGCGGCTGCACCCCGGCGACCGC
GCCATGATCTGCCTGGGCAACCGCGTCGAGATGGTGGAGAGTTACTTCGGCGTCCTGCGG
GCGAACGGCGTGGCGGTGCCGGTCAACCCGCGTTCGACCGATGCGGAACTCTCCTATCTG
CTCGCCGACAGCGGCGCCCGGCTGGTGCTCACCGATGTCGCCCACGCCGACCAGTTCGGC
CGGCTGCGGGAACAGTTCCCGGAGCTGAGGGTGGTGGTCAGCGGGGACGGCCCGCTGCCG
AAGGGCTTCATCGCGTTCGAGCCGCTGCCGGACACGGAGCCGCAGCTGGCAGCCCGCGAC
GACCTGGGCCTGGACGAAATCACCTGGATGCTCTACACCTCGGGCACCACGGGCCTGCCG
AAAGGCGTGCTGTCCACACAGCGGAACTGCCTGTGGTCCCTGGCCGCCTGCTACGTGCCG
GTGACGGGGCTGACCGCCGAGGACCGCGTGCTGTGGCCGCTGCCGCTGTTCCACAGCCTT
TCGCACATCGTGTGTCTGCTGGCGGCCACCGCCGTCGGGGCCAGCACCCGGATCGTGGAC
GGGGTGTCGACGGCCGATGTGCTGGACGCACTGCGCGAGGAGCGGTCGACCTTCATCGCC
GGAGTGCCGACGCTCTACCACCACCTGATCGAGGCGGCCCGCGAGCGCGACTTCGCCACG
CCCGAGCTGCGGATCGCGCTCGTGGGCGGGGCGGTGGCCACGGCGGACCTGGTCAGGTCG
TTCGAGTCCGCCTTCGGAGTGCCACTCGTCGACGCCTACGGCTCCACCGAGACCTGTGGC
GCGATCGCGGTGAACTGGCCAACCGGCCCGCGGGTCGAGGGGTCGTGCGGGCTGCCGGTG
CCGGGGCTGACGGTGCGGCTGGTGGACCCGGACACCGGTGTCGACGTTCCGGCCGGGCGG
GAAGGCGAGTTCTGGGTGTCCGGGCCGAACATCATGGCCGGGTACCACAACCAGCCGGAG
GCGACGGCCTCGGCGCTGCGCGACGGCTGGTACCGCACCGGGGACCTCGGCCGCCGCGAC
GAGGCCGGATTCTGCACGGTGACCGGCCGGATCAAGGAACTCGTCATCCGGGCCGGGGAG
AACATCCACCCCGGTGAGGTCGAGGCCGTGCTGCGCACCGTGCCCGGTGTGGCGGACGCG
GCCGTGGTGGGCAAGCCGCATGCGGTGCTCGGCGAGGTTCCGGTGGCCTTCGTGGTGCCC
GGCCCGGACGGCTTCGACCCGTCGGCGCTGCTGGCCACGTGTCGCGAGCGGCTGTCGTAC
TTCAAGGTCCCGGAGGAGATCTACGAGATCGCGCGGGTGCCACGCACCGCCTCGGGGAAG
ATCACCCGGCACGTACTGCTGGAGCTGCCCGCACGGCTGCGGGCCGCCGGAGACGGCCAG
TACGACTCGCTGCTGCGGCTGGATTGGGTGCCGCAGTCCGCGCTGCCGGACGCCCCGGCC
GGGACCGGTACCTGGGCACTGGCGGACGCCGACGCGCTCGGGCTCGCGGTGGGGCTGCGG
GCGGCCGGAGTGGACGCGCGGGTGGTGGGCGAGCCGGTGGGCGAGCCGGTGGCCGACTCC
GTGGCCGGTCTTGTGGCAGGCTCCGTGGCCGATCTCGCTGGAGATGACGGTGCGGCCCCG
GATGTGGTCGTGGTGACGCCTCCGGTGGCGGGCCTCCCGGATGAGACCGGGGCCCCTGAC
GAGGCCGGGGTCACGGTTGGCGAGCGCGCCGACCGGCTGGCGGCCCGCCTTGGCGCCTGG
CTGGCCGACGACCGGCTGGCCGGGACGACGTTCGTGGTGGCCACCACGGGCGCGGTGGCC
ACCGGCGCCGAGGAGGACGCACCGGAGCCGCTGTCGGCCGCGCTGTGGGGTGTGGTGCGC
TCGCTGCAGGCCGCCTACCCCGGCCGACTGACGCTGGTGGACGTGGACCTGGACGGGGCC
GGGGACAGGGCCGGGGACGGGGCCGGGGAGGACGGTCGGGAGGCCGCGCTGTTGCGGGCC
GTCCAGGGCGGGCACGACCAGGCGGCGATCCGTGGCGGAGTACTGCTGGTCCCGCGCCTG
ACCCGGATCTCGTTCCCCGCGGAGCCGGGGCCCGCCCCAACCCTGGACGCGGGCGGACTG
GTCGTGATCACCGGTGGCGACACCACCCGCGGCACCGCGCTGGCCCGCCATCTGGTGACC
GCGTACGGCGCCCGTAACCTGCTGCTGCTCAGCGCGAATGGCCTGCCGGAAGAGGCGGCG
GCCACGTTGCGGACCGAGTTGGCGCGGGACGGGGCCCAGGTCTCGATGGCCGTATGCGAC
CCGGCCGACCGGACGGCGCTGGACTCGGTGCTGGACGCACAGGCCCGGCCGGTGACCGCT
GCCGTACACATCGAGGAGCCGAGCCCGGAACGGTCGCTCGACACGTCGCTGCGCGCCATG
ACACACCTGGAAGAACGGACCCGGGGGGCCGCCCCGGCACTGTTCGTCGTCGTCACCTCC
GCCGCCGGGGTGCTGGGCTCGCCTGGCCGCCCGGACCGGGCGGCCGCCGACCAGTTCGGC
GAAGCCCTGGTGCGGCGGCGCCGGGCGCTTGGCCTTGGCGGGCTGGCTCTGGCCTGGGGC
CCGCTGCCGGGCGAGCATGGCACGGCGCCGGTGGCCGGTGCCGTTCCCCTGCCCGAGGCG
CTGGCCCTGTTCGACGCGGCGCTGACGGCTGGTCAGGGGCCGCTCGTGCTGCTCAGGCCG
AGCACGACGGGGCTGCCGGGTGGCGAGCCGGTGCCCGCGGTGCTGCGTCATCTGGTGGAC
GCGCCGTCCGGCGTACCGGCGTCGGACGAACCCGCCGTCGCGGAGTTCCGGCGGCGGCTG
GCCGCCGAGAGCGAGTCCGGCCGACAGCGCATGGCGCTGGCGCTGGTGCGCGAGCACGCC
GCGGCGACGTTGGGGCTGGCCTCGGCCGACCCGGTCGAGGCCGGCCAGGCATTCAGCGCG
TTCGGCTTCACCTCACTGACCGCGGTCGCGTTGAGGAACCGGCTGAACGCGGCCACCGGG
GCACGGCTCGCCGCCACGGTGGTCTTCGACCATCCGACCCCTGCCGGGCTGGCGCGGCAT
CTGGTGCGGGAGATCACCGGGAGGCGCGGCGTGCAGGCGCCGGTGCGAGCGCGCGGCGTG
TCCGACGAGCCGGTGGCGATCGTGGCGATGGGCTGCCACCTGCCGGGCGAGGTCGCGACG
CCCGAGGACCTGTGGCGGTTGGTGGCCGACGGGCGGGACGCGATCGCCGGGTTCCCGGAG
GACCGGGGCTGGGACCTGGCCGGGCTCTTCGACTCCGACCCGGACGCCGTGGGCAAGTCC
TATGTGCGCGAGGGCGGTTTCCTCACCGACGCGGGCGGATTCGACGCCGCATTCTTCGGC
ATCTCGCCCCGTGAGGCGCTGGCGATGGACCCGCAGCAGCGGTTGCTGCTGGAGACCGCG
TGGGAGACCTTCGAGAATGCCGGAATCGACCCGGGTTCGCTGCACGGCACCGACGTCGGT
GTGTTCAGCGGAGTGATGTACCACGATTACGGGGCCGACGCCGGGACGGCGGCGGAGGGC
CTGGAGGGGCATCTCGGCGTGGGCAGCGCGGGGAGCGTCGTCTCCGGGCGGGTGGCCTAC
GCGCTGGGCCTGACCGGGCCCGCGGTGACCGTGGACACCGCCTGCTCGTCCTCCCTGGTA
GCGCTGCACCTGGCGGTTCAGGCGGTGCGCACGGGCGAATGCTCGCTGGCGCTCGCCGGG
GGTGTCGCGGTGATGAGCAGGCCGACGTCGTTCATCGAGTTCTCCCGCCAGCGTGGCCTC
GCCCCCGACGGCCGCTGCAAGTCCTTCGCGGAGGGCGCCGACGGCACCAACTGGTCCGAG
GGTGTCGGGTTGGTGTTGCTGGAGCGGCTGTCCGATGCCCGCCGCAATGGGCATGAGGTG
CTCGCCGTCGTCCGTGGCACCGCCGTGAACCAGGACGGCGCCAGCAACGGCCTGACCGCG
CCCAACGGCCCGTCCCAGGAACGGGTGATCCGGCAGGCGCTGGCGAACGCCGGGCTGACG
GTGGCCGATGTGGACGCGGTCGAGGCCCACGGCACGGGCACGAGTCTCGGCGACCCGATC
GAGGCCCAGGCACTCCTGGCCACCTACGGGCAGGAGCGGCCGGAGGATCAGCCGCTGTGG
CTGGGGTCGTTGAAGTCGAACATCGGGCATGCGCAGGCGGCGGCGGGCGCGGCCGGTGTC
ATCAAGATGGTCCAGGCCATGCGGCACGGCGTACTGCCCAAAACCCTCCACGCCGACGAG
CCCACCAGCAAGGTCGACTGGACGTCAGGTGCGGTGTCGCTACTGTCCGAGGCCCGGCCC
TGGCCGGAGACGGGACACCCCCGCCGCGCCGGAATCTCCTCCTTCGGCGTCAGCGGGACG
AACGCACACGTGGTCCTGGAACAGGCACCCCTGGAAGCGGCTGCACCCGAAACACAGGCG
AGCGACGCGGGCGCTCCTGGGCTCGTGGCCACGGGCGGCGTAGTGCCGTGGGTGCTGTCC
GCCAAGACTCCTGCGGCGCTGCGCGCTCAGGCAGAGCGTCTGGTCAGCCATCTGGAGTCC
GGGAGCGACGCCAACCCGGTCGATGTGGGCTGGTCGCTGGCCACCACCCGGGCGGCGTTG
GAGCACCGCGCGGTCATCCTGGCGACGGATGCCGAAGGAGGCATGGCGACGGCGCGGGCT
CTGGCGGAGGGGCGGCCTGACCCGCTCCTGGTCACCGGACAGACCGGAACAGACGGCAAA
ACCGTGTTCATCTTCCCCGGCCAAGGCGCCCAATGGGTGGGCATGGGAGCCCAACTCCTC
AACACCTCACCCGTCTTCGCCGCCCGCCTGCGTGAGTGCGCCGATGCTCTAGCGCCGTAT
ACCGACTGGTCGCTCATCGACGTCATCACCGGCACGCCCGACGCTCCCTCGCTTGAGCGT
GTCGACGTCGTACAGCCCGCCACCTTCGCCGTCGTCGTCTCCCTCGCCGCACTCTGGCAA
TCCGTGGGCATCCACCCCGACGCCGTCATCGGCCACTCCCAAGGCGAAATCGCCGCCGCC
TGCGTCGCCGGACACCTCACCCTCACCAACGCCGCCAAAATCGTCACCCTCCGCAGCCAG
ACCATCGCCCACCACCTCGCCGGACACGGCGGCATGATGTCCCTCGCCACCCCCGCCGAC
ACCATCGACCTCACCAACTGGCACGGCAAACTCTGGATCGCCGCACACAACAGCCCCAAC
GCCACCGTCATCGCAGGCGACACCGACGCCCTGCACCAACTCCACACCCACTACACCGAC
CAGGGCACCAGAGCCCGCATCATCCCCGTCGACTACGCCTCCCACACCGGACACGTCGAC
ACCATCAAAAACCAGCTACAAGACGTACTCGACGGCATCACCCTCGAACCCGGCACCATC
CCCTGGCTCTCCACCGTCACCGGACAGTGGATCGAACCCAACACCGTCGGCGACAGCTAC
TGGTACCGCAACCTCCGCCAAACCGTGCAATTCGAGCACACCATCCACACCCTCGCCGAC
CAGGGCTACCGCACCTACATCGAAATCAGCCCCCACCCCGTCCTCACCACCGCCATCCAA
GAAACCCTCGAAGCCAACGACACCCCCAACACCACCATCGTCACCGGCACCCTCCGCCGC
GACGACGACACCCCCACCCGCCTCCTCACCAACCTCGCCCACCTCACCACCAACGGAACA
CCAGTCAACTGGCCCACCCTCTTCACAGGCACCCAACCCACCCGCATCCCCCTCCCCACC
TACCCCTTCCAACACCACCACTACTGGCTCCCCCGCAACACCAGCGCAGGCGATGTGAGT
GCCGTGGGCCTCCAGGGCACGGGCCACCCGCTGGCCGGGGCCGTGGTGAGCGTGCCCGAC
ACCGGGGGTGTGCTGCTCACCGGGCAGTTGTCGGTGGCCACCCACCCGTGGCTGGCCGAC
CACGCCGTCTCCGGAACGGTGCTGCTGCCGGGCACCGCGATGGCCGAACTCGCCATCCGC
GCCGGAGACGAGACCGACACCCCCACCCTGGAAGAGCTGGTCATCGGCCAGCCGATGACA
CTGCCCGAAGACGGTGCACTACATGTCCAGGTACTGGTCGGCGGCGTGGAGGACGGGCGC
CGAGGGGTGCGGATCTACTCTCGCCCCGACGCGGCCCAGGAACAGGAATGGCTGGAGCAC
GCCTCGGGCACACTCGCCACGCAGCCGGACGGTTCGGCCGAGGGCGGCATGGAGAACGGC
ATGCCCGAGTGGCCGCCGCCCGGTGTCGAGCCGATCGCTCTGGATGACTTCTACGACGAC
CTCGCCCAGGCCGGGTATGAGTACGGGCCCGCCTTCCGCGGGCTGAAGGCGGTCTGGAAG
CGCGATGGCGAGGTGTTCGCGGAGGCCGCGCTGCCGGAGGAGCAGACGGACGTCGCCGGC
CGGTTCGGTATCCATCCGGCGCTGCTGGACGCCGCGTTGCACGCGAGCAACTTCTGTGTG
CCCCCGGCCCCGGGCCAAACGCTCCTCCCCTTCGTGTGGAACGGCGTACGGCTGCTGGCG
GCGGGAGCCACGGCCGTCCGTGTGCGCGCCCGCGCCACCGGCACGGACTCGTTCACGATC
AGCCTGTTCGACAGCACCGGCTCCCCCGTCGCCTCGGTGGACTCCCTGGTGCTCCGGGCG
ATCAGTCCCGAGCAGCTCGCTGCCGCCTCCGGCGGTGCCGGTCGGTCCGCTGATGCGCTG
TTCACGCTGGACTGGACCGAGCACCCCACCGCCCTGGGGACCGAGGTTTCCTGGGCCACC
CTCGGCGATGCCCACACCGACGTGGACGCCCACGTGGACGCGCTCATCGCGGGAGAGGAC
CGGCCCGGGGCCGTGGTCGCCGACACCGCGGCCTGGGCCGCCGGGGACACCGGCCTGCCC
GCGCGGGCCCGGGATCTGGCCGCCCGCGCGCTGGACCTGGTGCAGCGGTGGGTCGGCCGA
CCCGAACTCGCCGACGTCCGGCTCGTGTTGCTCACTCGTGGGGCGGTGTCCGTGCACGAC
ACCGCCGAGGTCACCGACCCGGCCGCCGCCGCGATCTGGGGCCTGGTCCGCTCCGCCCAG
TCCGAACACCCGGGCCGGATCGCCCTGGTGGACACCGACGACGTGTCGCGGGAGGCGCTG
CCCGAGGCGGTGGCGGCCGGCGAGCCGCAAGTGGCGCTGCGCCGTGGGCTGCTGTGGGTG
CCTCGTCTGGTGCGGTCGCCGCAGGGTCTCGCCGTACCCGCGCACGAGCACTGGTACCTC
GACGTCTCGGAGAAGGGCAGCCTGGAGAACCTGGTGCTGCGGCCGGATCCGGAGGCCACC
GCGCCGCTGGCCACCGGTCAGGTCCGGATCGAGGTCCGCGCCGCCGGTCAGAACTTCCGG
GACGTACTCGTCGCGCTCGGCGGCGTGGCGGGTCAGGAGGGTCTGGGCGGCGAGGGTGCC
GGGGTGGTGACCGAGGTCGGGCCCGGGGTCGAGGGCCTGGCGGTGGGCGACCGGGTGATG
GGCCTGTTCCCGCGCTCGTTCGGCCCGCTGGCCATCGCGGACGCGCGCACGGTCGCGCCG
ATCCCCGAGGGCTGGTCGTACGCCACGGCCGCCGGGGTGCCGGTGGCCTATCTGACGGCA
CTGTACGGGCTGCGGGACCTGGGCACCGTACAGCCGGGTGAGACGGTGCTGGTGCACGCC
GCCGCGGGCGGTGTGGGCATGGCCGCCGTCCAGTTGGCGCGGCACTTCGGCGCCACCGTG
TACGCCACCGCCCACCCGTCGAAGCACCATGTGCTGACCGCGCTGGGGGTGCCGGAGGGG
CATCTGGCGTCCAGCCGCGACCTCGGTTTCGCCTCGGCGTTTCCCGCGCTGGATGTGGTG
CTGAACTCCCTCACCGGCGAGTATGTGGACGCCTCGCTGGGGCTGCTCGGCACGGGTGGC
CGTTTCGTGGAGATGGGCAAGAACGACATCCGCGATCCCGCCTCGGTCGCCGCAGCACAT
CCCGGTGTGGGCTATCAGGCGTTCGACCTGGGAGGTGACGCGGGCCCTGACCGGATCCGG
GAGCTGCTCGCGGAGCTGGTGGAACTGTTCGAGGCGGGCCGGATCGAGCCGCTTCCGATA
CGGCACTGGGACGTCACCCAGGCGCCGACGGCCTTCCGGTGGATGAGCCAGGGGCGGCAC
ACCGGCAAGATCGTGCTCACCCTCCCCCGAGCCCTGGACCCGGACGGCACCGTCCTGATC
ACCGGTGGCACCGGAACCCTCGGCGCCACCATCGCCCGCCACGTCGTCACCCACCACGGC
GCGCGCCAGTTGCTCCTCATCAGCCGTCAGGGTCCCGACGCCCCCGGCGCCACCGATCTC
ACCACCGAACTCACCGAACTCGGCGCCACCGTCCGCATCACCGCCTGCGACACCGCCGAC
CGCGACCAACTCGCCGCGCTCCTCGCCGACATCCCCGCCGCCCACCCCCTCACCGCCGTC
ATCCACACCGCCGGCGCCCTGGACGACGGTGTCCTGACCGCGCTCACCCCGGACCGCCTC
GACACCGTCTTCCGCCCCAAGGTCGACGCCGTCACCCACCTCCACGACCTCACCCGCGAC
CAGGACCTGGCCGCGTTCGTCATCTACTCGTCCGCCGCCGGAACGCTCGGCAACGCGGGG
CAGGCCAACTACGCCGCCGCCAATGCCTTCCTCGACGCCTTCGCCCAGTGGCGGCACGCC
CGCCACCGGCCCGCCACTTCGCTGGCGTGGGGGCTGTGGAGCGACACCAGCACGCTCACC
TCGACGATGGACGCCACCGACGTACGCCGCACACGGCGGGCGGGGGTGCTGGGCATGGAC
AACGCCGAGGCGCTGCGGGTGTTCGACACCGGGTTGCGGTCCGGGCGGCCCGCGCTGGTG
GCCGCGAAGATCGACCTCACCGCCCTGCGCGCGCCGGACGCCGAGTTGTCGCCGCTGCTG
CGCGGACTGGCCCGTCCGGCGCGCCGCACCGCGCGCACCGCGGCCCCGGCGGCCGGTGGT
CTGTCGGGGCAGCTGGCCGGGCTGTCCCCCGCCGGGCAGCGGGAGTTCCTGCTCAACCTG
GTGCGGGCGGAGGCCGCGGTGGTCCTCGCCCACGCCGGTCCTGAGGCGATCGAGCCGACC
GTGGCGTTCAAGGAGATGGGTTTCGACTCGCTGACGGCGGTCGAACTGCGCAACCGGCTG
AATGCGGCGACCGGGCTGCGGCTCCCCGCCACGTTGCTCTTCGACCACCCGACTCCGGCT
CTTCTCACCGAGCTGTTCCATACCGAGTTGGGCGGCGGCCCGGCACCCGCCGCGGCGGCC
CCGGTGACCGTGCGTGCCGCCGCTGACGAGCCGATCGCCGTGGTGGCGATGAGCTGCCGT
CTGCCGGGCGGGGTGACCGACCCGGACGGGCTGTGGAACCTGCTGCTCGAAGAGCGCGAC
GGCATCGCCGACTTCCCCCGCGACCGGGGCTGGGACTTGGAGGCGCTGTTCGACGCCGAC
CCGGACCGGAGTGGCACCTCCTATGTGCTGCGCGGCGGGTTCCTCGAGGACGCGGCCGGT
TTCGACGCGGACTTCTTCGGCATCTCGCCACGTGAGGCGCTGGCGATGGACCCGCAGCAA
CGGCTGTTCCTGGAAGCCTGCTGGGAGGTGTTCGAGCGGGCGGGCATGGACCCGACGACG
GTGGGTGGCGGCGACATCGGCGTGTTCGCCGGCGTCATCAACCAGGACTACGGCGTGCGG
AGCGGGCCCGCTCCCGAGGACCTTGAGGGCTATATGCTCACCGGCTCGGCGACGAGTGTC
GCCTCCGGCCGGGTGGCCTATGTGCTGGGCCTGGAGGGCCCGGCGGTGACGGTGGACACG
GCGTGCTCCTCCTCACTGGTGGCCATGCACTGGGCCGTACAGGCGCTGCGCCAGGGCGAG
TGCTCGATGGCACTGGCCGGGGGTGCCACGGTGATGGGGCGGCCGTCGGCGTTCGTGGAG
TTCTCGCGCCAGCGTGGCCTGGCGCCGGACGGCCTGTGCAAGGCGTTCGGCGCGGGTGCC
GACGGCACCACCTTCAGCGAGGGTGTCGGGGTACTGCTGCTGGAACGGCTCTCCGACGCC
CGCCGCAACGGCCACGAGGTGCTGGCCGTGATCCGCGGTACGGCGGTCAACCAGGACGGC
GCCAGCAACGGCCTCACCGCCCCCAACGGCCCCTCCCAACAGCGGGTGATCCGGCAAGCA
CTCGCGAACGCCGGGCTGTCGGCCACCGACATCGACGCCGTCGAAGCCCACGGCACCGGC
ACCGCCCTCGGCGACCCCATCGAAGCCCAGGCACTCCTGGCCACCTACGGCCAGGACCGG
CCGGGAGACGAGCCCGTATGGCTCGGCTCGCTGAAGTCGAACACCGGGCACACGCTGGCC
GCGGCAGGCGTGTCCAGCGTCATCAAGATGGTGCTGGCGATGCGGCACGGCACGCTTCCG
CGCTCCCTGTACGCCGACGAGCCCACGCCGGAAGTGGATTGGTCCCAGGGCGCGGTGTCC
CTGCTCACGGAGGCCCGGCCCTGGCCGGAGACGAGCCACCCACGCCGCGCCGGGATCTCC
TCCTTCGGCATCAGCGGCACCAACGCCCACCTCATCCTGGAGCAGGCGCCCCAGTCCGAG
ACCGAGCCCGAAGCCGCGCCGAAGGCGGACGGCGGCATGGACACCCCAGGGCTCGTGGCG
ACCGGCGGGAGCGTGCCCTGGGTGCTGTCCGCCAAGACCCCCACGGCCCTGCGGGCTCAG
GCTCAACGACTCCTGGACCACCTGGAATCCGGGGTGACCGACCGCCCCCTCGACATCGGC
TGGTCCCTGGCCACCACCCGCACCCTCCACGACCACCGCGCCATCATCCTCACCGACACC
GAGGGCGGTGACGCCACAGCCGCCCTCACCGCCCTCGCGACCGGACAACCCCACCCCCGC
CTCACCACCGGCCACGCCACCACCCACGGCAAGACCGTCTTCGTCTTCCCCGGCCAAGGC
GCCCAATGGCAAGGCATGGGAGCCCAACTCCTCGACACCTCACCCGTCTTCGCCACCCGC
CTCCACGAATGCGCCGACGCCCTCGCCCCCTACACCGACTGGAACCTCATCGACGTCATC
ACCGGCGCACCCCACGCCCCTTCGCTCGACCGCGTCGATGTCCTGCAGCCGACCACCTTC
GCCATCATGGTCTCCCTCGCCGCACTCTGGCAGGCCAACGGCATCCACCCCGACGCCGTC
ATCGGCCACTCCCAAGGCGAAATCGCCGCCGCCCACATCGCCGGACACCTCACCCTCACC
GACGCCGCCAAAATCGTGGCCCTGCGCAGCCAGACCATCGCCCACCACCTCACCGGACAC
GGCGCCATGATGTCCGTCCTCGCCTCCCACACCTGGGTTCAAGAAGCACTGGCTCCCTGG
CACGGACACCTGTGGATCGCAGCCGTCAACGGCCCCGCCTCCGTATCCGTCTCCGGAGAC
CCCGACGCACTCGCCGAATTCGGTGTCACCCTCTCCAAGGCGAAGGTCTACCGCTGGCAG
TTGCCCGGGGTGGACTTCGCCGGACACTCCGGACACGTCGACACCATCAAAGACCAGCTA
CACCACGTACTCGACGGCGTCACCGCCTCCCCCGGCACCGTGGCCTGGATGTCCACCGTC
GACGCCGACTGGGCCAACCCCACACACATCGACGCCCACTACTGGTACCGCAACCTCCGC
GACACCGTCCGCTTCGAAGAAGCCACCCGAGCCCTCCTCACCCACGGCCACCGCGTCTTC
ATCGAAATCAGCACCCACCCCGTCCTGACCACCGCCATCCAGGACACCACCGAAACCCTC
CCCGAGGTCCGGGCCACCATCACCGGCACCCTCCGCCGCGACGACGGTGGCCCCGACCGC
GTCCTCACGAGCCTCGCGGAGCTCTCCACCGCCGGAATTCCGGTCCACTGGCCCACCGCG
TACGCCGGAACCACACCCTCCCAAGTCCCCCTGCCCACCTACCCCTTCCAGCACCAGCAC
TACTGGCTGGCCGCCACCGGCCACCACGGGGATGTCGGCTCCGTGGGACTGCGCGACGCG
GCGCACCCGCTGCTGGGGGCCGTGGTCAGCGTGCCGGACACCGGAGGGGTGCTGCTCACC
GGGCGGCTGGCACCGTCGGCGCAGTCCTGGCTGGCCGACCACATGCTGTCCGGCGTCGCC
CTGGTGCCGGGTACGGCGATCGTGGAACTGGCCGTACGGGCCGGGGACGAGACGGGCACG
CCGGTGCTGGAGGAGCTGGTCCTCGGCCAGCCGATGCTTCTCCCCGAGGACGGCTCGCTT
CAGGTGCAGGTCCTGGTCGGCGCTGCCGAGGACGACGAGCGCCGTGCGGTGCGTGTCTAC
TCCCGCGGCGACGAGTCCGAGCCGTGGGTCGAGCACGCGTCCGGCATCCTGTCCGCGCAC
GCGCTCGTTCCTGTCGAGGCAGAGCGGCAGTGGCCGCCCACCGGGGCGGAGCCCGTTGTC
CTGGAGGGCTTCTACGACCGCCTGGCCCAGGCAGGCTATGAGTACGGTCCGGTGTTCCGC
GGGCTCACCGCAGCGTGGACCCGCGGCGATGATGTGTTCGCCGAGATCACCCTCGGCGAG
GACCAGCACGACCTCGCGGGCCGCTTCGGGATCCATCCGGCGTTGCTGGACGCGGCACTG
CACGCGAGCAACTTCTGCCCGGGCAACGAGCCCGGCGGCGGGACGTATCTGCCGTTCTCC
TGGAACGGCGTGCAGTTGCACGCCGACGGCGCCACCGCCCTGCGGGTGCGGGTCACCTCC
ACCGGGCCGGACAATCTGTCCCTGCACGCGACCGATCCGCACGGGGTGCCCGTGGTGACC
GTCGGCTCGCTGGTGCTCAGGGAGACCACCGCGGAGCAGCTCCGCACCACATCGGCCACG
TCCGCCGCGGACTCCCAGTTCACCGTGGAGTGGACCGAACATCCCCTGGCCCGGGACGAG
GTGGCGTGGGCGGCGCTGGAGGCCGTGCAGGACGACGATACGTGGCCGCCGGTGGTCGTC
GCCGACACCCGGGCGTTCGCCGCGCAGGGCGGCGGACTGCCGGACGAGGGCGGACTGCAG
GAGGACGGCGAACTACCGGAGCGCGCCCGTGAGCTGACCGGCCGGGCACTGGCCGCGATA
CAGCGTCTGATCAGCGACGACGCACTCGCCGACAGCCGCCTGACGCTGCTCACCCGGGGT
GGCATGGCGGTGCATGACGACACCGAGGTCACCGACCCGGCCGCCGCCGCGGTGTGGGGC
CTGGTGCGCGCCGCGCAGGCCGAGCACCCGGGCCGGGTGTGCGTGATCGACATCGACGAC
CGGTCGGCCGAGGCCCTGACCGCCGCGCTGGCCACGGAGGAACCCCAGCTCGCGCTGCGG
GGCGGAACCGCGTGGGTGCCCCGCCTGGTGCGAGCGCGCCCGGGACTGGCGGTCCCGGCG
GCCGTGGCGTGGCATCTGGACGTCACCGAACACGGCACGCTGGAGAACCTCGCCCTGGTG
CCCCATCCCCGGGCGGAGGCACCGCTGGAGGCGGGCCAGGTGCGGATCGCGGTGCGCGCC
GCCGGCCAGAACTTCCGCGATGTGCTCATCGCCCTCGGCATGTACGAGGCGGAGATCGGC
ACCGAGGGCGCCGGCGTGGTGACCGAGGTCGGCCCGGGCGTGGCGGACCTGACCGTGGGC
GACCGCGTGATGGGCATGTTGCCCGGTTCGTTCGGGCCGCTGGTGGTGGCGGACCGGCGG
ACGGTGGTGCGGATGCCGCGCGGCTGGTCGTTCACGGCTGCGGCCGGGGTGCCGGTCGCC
TATCTCACCGCGTTGTACGCGTTGCGGGATCTGGGCGATGTCCAGCCGGGTGAGACGGTG
CTGGTGCACGCCGCCGCCGGTGGTGTCGGCATGGCCGCCGTACACCTCGCCCACCACTTC
GGCGCCACCGTCCTCGCCACCGCCCACCCGGCCAAACACCACAGCCTGGAACAGCTCGGG
GTGCCCACGGAACGACGCGCCTCCAGCCGCGACCTCGCCTACGCCCGCACCTTCCCGACC
GCCGACATCGTCCTCAACTCCCTCACCGGCGAACACATCGATGCCTCCCTCGGGCTCCTG
GCCCCCGGCGGCCGTTTCATCGAGATGGGACGCACCGACATCCGGGACGTGGACGAGGTG
CGCGCGTCCCATCCGGACCGGACATATCGCGCGTTCGACCTGGGCGCGGACGCTGGGCCG
GACCGCATCCAGGAGCTGCTGGCCGAGCTGGTGGACCTGTTCGAGCAGGGCCTGATCCCT
CCGTTGCCCACCCGGCCGTGGGAGATCACCCGCGCCCCCGACGCATTCCGCTGGATGAGC
CAGGGCCGCCACACCGGCAAGATCGTGCTCACCCTCCCCCGCATCCCCGACCCCGAGGGC
ACCGTACTGATCACCGGCGGCACCGGCACCCTCGGCACCGCCATCACCCGCCACCTCGTC
ACCCACCACGGCGTACGCAACCTGGTCCTCGCCAGCCGCCAGGGGCCGAACGCCCTCGGC
GCGGCCGACCTCCACGACGAACTGACCGCACTGGGCGCACAGGTACGCATCACCGCCTGC
GATATCGCCGACCGCGGCCAACTCGCCGCGCTCCTCGCCGACATCCCGTCCGACCACCCC
CTCACCGGCATCGTGCACACCGCCGGCGCCCTGGCCGACGGCACCCTCACCACACTCGAC
CCCGACCGCATCGACACCGTCTTCCGCCCCAAGGTCGACGCCGTCACCCACCTGCACGAC
CTCACCCGCGACCAGGACCTGGCCCTCTTCGCCGTGTACTCCTCCGCCGCCGGAATCCTC
GGGAACGCGGGTCAGGCCAACTACGCCGCCGCCAATACCTTCCTCGACGCCTTCGTACAG
CGGCGGCGCGCGGCGGGGCTCGCCGGGCTGTCACTGGCCTGGGGCCTGTGGGCGGAGACC
AGCGACCTGTCGGCCGCGCTGATCACGGCCAACCGGGATCGCACCCAACACGGTGTCGTC
CGCCCGATGGCCACCGAGCACGCCCTGAGCCTCTTCGACTCCGCGCTCGGCCTGGGGTTG
TCCCTGGTGGTACCGGCGAAGCTGGACCCGGGCGCGCACGAGTCCGCCGCGGGCGCTGTG
CCGCCGCTGCTCACCGGCCTCCTCCGGCCGACCCGGCGCACCTTGCGGTCCACGGCGGGC
CAATCCGGCGAAGGCGGTCTCACGGCCCGGCTGGCGGCGCTGTCCGAGGCCGACCAGCAC
CGGCTGCTGCTGGACCTGGTACGGGACCATACTGCGACCGTACTCGGGCACGCCGGGAAG
GACGCCGTGGACGCCAGGCGCGCGTTCAGCGAGATCGGGGTCGACTCGCTCATCGCGGTG
GAACTGCGCAACCGGCTCGCCGGCGCGACCGGGCTGCGCCTGCCCGCGACGGTCGTGTTC
GACTACGCGACACCGGAGGCGATGGCCGGGCATCTGCGGTCCGTGGTGGCCGGAGACACG
GCCGCCCCTGCCTCCCCGTCGACGTCGGCGGTGGCGCCCGCTTCCGCGGTGGCCCCGGCG
GACGACCCGGTGGCCATCGTGTCGATGAACTGCCGGCTGCCCGGCAAGGTCACCGGCCCC
GGGGAGCTGTGGGATCTGGTGTCCCAGGGCCGGGACGCGATCGGCCCGTTCCCCACGGAC
CGCGGCTGGGACGTGGAGACGCTGTTCGACCTCGATCCGGACGCCGTGGGCAAGTCCTAC
GTACGCGAGGGCGGTTTCCTCACCGGCGCCGGCGACTTCGACGCCGAGTTCTTCGGCATC
TCGCCGCGTGAGGCGCTGGCGATGGATCCGCAGCAGCGACTGCTCGCCGAGACCTCATGG
GAGCTGTTCGAGCGGGCGGGCATCGACCCGGTGTCCGTGCGCGGACAGGCCATCGGGGTG
TTCGCCGGGGTCATCGACCAGGGATACATCGCCCACTCCGAGGCCCCTCCGCCGGAGTTG
GAGGGCTACCTGATGACGGGCAGCACCACGAGTGTGGCCTCCGGCCGAGTGGCCTACCTG
CTGGGCCTCGAAGGCCCCGCGGTGACGGTGGACACGGCGTGCTCGTCGTCGCTGGTGGCG
CTGCATCTGGCCGTGCAGGCGCTGCGGGCGGGCGAGTGCTCGATGGCCATCACCGGTGGC
GTGACGGTGATCGCCAAGCCCGGCGGTTTCATCAGCTTCTCCCGCCAGCGCGGGCTCGCG
CCGGATGGCCGCAGCAAGTCCTTCAGCGAGGGCGCCGACGGCACCAGCTTCAGCGAGGGC
ATCGGTCTGGTGTTGCTGGAACGGCTCTCCGACGCCCGCCGCAACGGCCACGAGGTCCTG
GCCGTGATCCGTGGCACGGCGGTGAACCAGGACGGCGCGAGCAACGGCCTCACCGCGCCC
AACGGACCCTCCCAGCAGCGAGTGATACGGCAGGCGCTGGCGAACGCCGGGCTGACGGTG
GCCGACGTGGACGCGGTCGAGGCCCACGGCACCGGCACCGCCCTCGGCGACCCCATCGAG
GCCCAGGCACTCCTGGCCACCTACGGCCAGGACCGGCCGGGGGACGAACCGCTGTGGCTC
GGTTCGCTGAAGTCCAACATCGGGCACACCCAGGCCGCCGCGGGCATCGCGGGCCTCATC
AAGATGGTGCTGGCGATACGGCAGGGCACGCTTCCGCGGTCCCTGCACGCCGGCGAACCC
ACCACCAAGGTCGACTGGACGTCGGGCGCGGTGTCGCTGCTGTCCGAGGCCCGGCCCTGG
CCGGAGACGGGACACCCCCGCCGCGCCGGAATCTCCTCCTTCGGCATCAGCGGGACGAAC
GCACACGTGATCCTCGAGCAGGGGCCGGAGGTGGCTGTGCCCGCAACGGAGGCGCGCGAC
GCGGGCGCTCCTGGGCTGGTGGCCACGGGCGGCGTGGTGCCGTGGGCGCTGTCCGCCAAG
AGCCCTGCGGCGCTGCGGGCCCAGGCCGAGCGTCTGGTCAGCCACCTGGAATCCGGGGAC
GCTCCGCGTGCGGTGGACGTGGGCTGGACGCTGGCCACCACCCGAGCGGCGTTGGAACAC
CGCGCGGTCATCCTCGCCACCGACACCGAAGACGGCATCGCCACCGCCCGCGCCCTGGCG
GAGGGACGGCCTGACCCGCTCCTGGTCACCGGGCAGACCGGGACGGACGGCAAGACCGTG
TTCGTCTTCCCTGGTCAGGGGGCCCAGTGGGTGGGCATGGGAGCCCAACTCCTCAACACC
TCACCCGTCTTCGCGGCTCGCTTGAACGAATGTGCCGAGGCCCTGGCCCCGTATACCGAC
TGGTCGCTGATGGACGTCATCACCGGCGCTCCCGGCGCCCCTTCGCTCGAGCGTGTCGAT
GTCGTACAGCCCGCCACCTTCGCCGTCGTCGTCTCCCTCGCCGCACTCTGGCAATCCGTG
GGCATCCACCCCGACGCCGTCATCGGCCACTCCCAAGGCGAAATCGCCGCCGCCTGCGTC
GCCGGACACCTCACCCTCACCAACGCCGCCAAAATCGTCACCCTCCGCAGCCAGACCATC
GCCCACCACCTCGCCGGACACGGCGGCATGATGTCCGTCCTCGCCTCCCGGGAACAGGTC
GAGGAAGCCCTCACCCCGTGGCACGGCAAACTCTGGATCGCCGCACACAACAGCCCCAAC
GCCACCGTCATCGCAGGCGACACCGACGCCCTGCACCAACTCCACACCCACTACACCGAC
CAGGGCATCAGGGCCCGCGTCATCCCCGTCGACTACGCCTCCCACACCGGACACGTCGAC
ACCATCAAAAACCAACTCCACCAGACCCTGGCCGACACCACGACCGAGCCCGGCACCATC
CCCTGGCTCTCCACCGTCACCGGACAGTGGATCGAACCCGACACCGTCGACAGCGGCTAC
TGGTACCGCAACCTCCGCCAAACCGTGCAGTTCCACACCGCCATCACCGCCCTCGCCCAT
GAGGGCTACCGCACCTTCATCGAAATCAGCCCCCACCCCGTCCTCACCACCGCCATCCAA
GAAACCCTCGAAGCCAACGACACCCCCAACACCACCATCACCGGCACCCTCCGCCGCGAC
GACGACACCCCCACCCGCTTCCTCACCCACCTCGCCCACCTCACCACTCACGGCCACACC
CCCGACTGGACCGCCCTCTACTCCGCCACCCACCCCCGCCCCACGCCCCTCCCCACCTAC
GCCTTCCAACACCACCACTACTGGCTCACGCCGTCCGAGGTACCGGAGGCGGTGGCCGAC
GGTGTGTTCTGGGACGCCGTGGAGCGGGGCGACCTCGCCTCCCTGGCCGATTCACTCGGC
GTCGAGGAGAAGACGCTGGAGCCCGTGCTGCCGGGGTTGACGTCGTGGCGGCGCCGCAAC
CAGGACCAGTCCACCGTGGACACCTGGTCGTATCGCATCGCCTGGGATCCGGTGGCGACC
GGAGAGGCGCCCGTACTGCCGGGAGCGTGGCTGGTGGCCGTGGCCTCACCGCAGGCGAGC
GACGCCGCGGTGACGGACGTGGTGGCCGCACTGGCCGCGCACGGTGCCGATCCCGTGGTG
GTCGAGGTCGACACGGTGGAACAGGCGGAGGTGACCGCGCGCCTGCGGGAGCGGATATCC
GATTCCGATGACGAGTACGCCGGAGTGGTGTCCCTGCTGGCGTGGGACGAGCGGAGCTAC
GAACCCGGCACGCTCTCCCGGGGCGTGGCGGCCACGGTGGCGCTGATACAGGCCGTGGAG
GAGATCGGGCTCGCCGCTCCCCTGTGGTGCCTGACGCGTGGCGCGGTCGCCGTGCGTGAG
CCCTCCGAGGTGACCAGCGAGTTCCAGCCGCTGGCCTGGGGAATGGGCGTGGTGCAGGGG
CTGGATCAGCCGTCCACCTGGGGCGGGATCGTGGATCTGCCGCGGACGCCGGACGAGACG
GCCCTTGTCCGGTTGTGCTCGGTGCTTGCCGGAGTGGACGCGGAGGACCAGGTCGCGGTG
CGCGCGTCGGGGGTGTTCGCCCGGCGGATGCGGCGCGAACCGGTGACGTCGGCACCGGCG
TGGCAGCCACGGGACACGGTGCTGATCACCGGTGGCACCGGCGGGCTCGGTTCGTACGTG
GGCCGTTGGGCCGCGGGTCACGGCGCCCGGCGTGTGGTGCTGCTCAGCCGTCAGGGTGCG
CAGGCGCCGGGCGCGGCGGAGCTGGAGGCCGAGCTGAGCGCACTGGGCGCGGATGTGACC
ATCGCGGCGTGTGATGTGACCGACCGGGACCAGCTAGCGGCCGTCCTGGCGGAGATCCCG
GATGACGCGCCACTGTCGGGCGTGGTCCACGCCGCGGGGCTGGCGCTGCCGGAGAAGCCG
CTGTCGAAGATGACACTCGCCGAGTTCGCCGACATCGGCCAGGCGAAGATCGCCGGTGCG
CGGCATCTCGACGACCTGTTGGGGGAGCGGGAGTTGGACGCCTTCGTCCTGTTCTCGTCC
GGAGCGGCGGCCTGGGGCAGCGGCGGCCAGAGCGCCTACGCCGCCGGCAACGCCTACCTC
GACGGGCTGGCGCAGCGCCGCCGCGCACGGGGGCTGGCGGCCACGTCGGTGGCGTGGGGC
GCCTGGGGCGGTGGCCTTGGCACGATCGACGAGATGATGGGCGCGCAGTGGCGCCGTACA
GGTCTGATGACCATGGACCCGCGGCTGGCGGCGCTGGCGATGGCACACACCGTGGGCAGC
GGCACCGCCCACGGTGTGGTGGCCGACATCGACTGGGAACGGTTCGCCCCCGGCTACACC
ATGGCCCGGTTCCGGCCCCTGCTGCGGGGACTGCCCGATGTCATCGACCTGCTGACCGAG
GACGCACCCGAGGACAGCGCGGGACAGACGGAGCTGATCGCACGGCTGGCCGGACTGAGC
CCCGAGGATCAGGAGCGGCTGCTCACCGAGCTGGTGCAGGCCGAGGCCGCGGCCGTACTC
GGACACGTGAGCGCCGACGCCACCGGGGACCGTCCGTTCAGCGAGATCGGATTCGACTCG
CTGACGGCGGTGGAGCTGCGCAACCGCCTCAATGCCAGCACGGGGCTGAGGCTGCCCGCG
ACGATGGTGTTCGACCACCCGCGGCCCAGTGTGCTGGCACGCCGTATCCGCACCGAACTC
GGCCATACCGACACCTCGTCGGTGGACTCGGTGCTGGCCGAGCTGGAGCGGCTGGAAGCA
CATTTGGCGGCGCTGCCGAAGGAGAAGATCGAACGCGCCCGGATCACCTCGCGGCTCCAG
CGGATGACCACCAAGGTCGCCGAGATCGAGGCCGTCGGCACGGGCGGCGACACCGTCACC
GAACGACTCGACACGGCGAACGCCGACGACGTGTTCGCCTTCATCGACCAGGAGTTCGGC
GTGGACTGA
[0] A36..442
[0] PCP1012..1082
[1] KS1102..1478
[1] AT1642..1960
[1] methylmalonyl-CoA1832..1836
[1] DH2009..2175
[1] ER2486..2786
[1] KR2796..2976
[1] ACP3073..3147
[2] KS3169..3543
[2] AT3713..4034
[2] methoxymalonyl-ACP3906..3910
[2] DH4082..4242
[2] ER4552..4850
[2] KR4860..5040
[2] ACP5143..5213
[3] KS5242..5617
[3] AT5780..6099
[3] methylmalonyl-CoA5972..5976
[3] KR6405..6585
[3] ACP6684..6757
[0] A106..1326
[0] PCP3034..3246
[1] KS3304..4434
[1] AT4924..5880
[1] methylmalonyl-CoA5494..5508
[1] DH6025..6525
[1] ER7456..8358
[1] KR8386..8928
[1] ACP9217..9441
[2] KS9505..10629
[2] AT11137..12102
[2] methoxymalonyl-ACP11716..11730
[2] DH12244..12726
[2] ER13654..14550
[2] KR14578..15120
[2] ACP15427..15639
[3] KS15724..16851
[3] AT17338..18297
[3] methylmalonyl-CoA17914..17928
[3] KR19213..19755
[3] ACP20050..20271

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [36-442]  1.5e-108 PF00501
PF00501   AMP-binding
IPR001227 Acyl transferase domain (Domain)
 [1634-1765]  G3DSA:3.40.366.10 [1832-1951]  G3DSA:3.40.366.10 [3703-3836]  G3DSA:3.40.366.10 [3906-4024]  G3DSA:3.40.366.10 [5772-5903]  G3DSA:3.40.366.10 [5972-6089]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [2796-2961]  1.99999999999999e-61 PF00106 [4860-5027]  4.6e-59 PF00106 [6406-6572]  1.5e-55 PF00106
PF00106   adh_short
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [2613-2634]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [3105-3120]  PS00012 [5171-5186]  PS00012 [6715-6730]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1016-1081]  5e-09 PF00550 [3081-3144]  3.5e-11 PF00550 [5147-5212]  8.80000000000003e-09 PF00550 [6692-6756]  8.3e-10 PF00550
PF00550   PP-binding
 [1011-1086]  1.99999999999999e-77 G3DSA:1.10.1200.10 [3074-3151]  1.99999999999999e-77 G3DSA:1.10.1200.10 [5142-5215]  1.99999999999999e-77 G3DSA:1.10.1200.10 [6688-6761]  1.99999999999999e-77 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1005-1119]  1.39999892049878e-21 SSF47336 [3070-3186]  1.20000117458134e-26 SSF47336 [5136-5258]  3.30000526807186e-24 SSF47336 [6679-6764]  2.60000517657733e-19 SSF47336
SSF47336   ACP_like
 [1012-1082]  PS50075 [3073-3147]  PS50075 [5143-5213]  PS50075 [6684-6757]  PS50075
PS50075   ACP_DOMAIN
IPR011032 GroES-like (Domain)
 [2477-2620]  3.30000526807186e-29 SSF50129 [4540-4684]  6.90001478563507e-31 SSF50129
SSF50129   GroES_like
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [2506-2561]  4.40000000000001e-06 PF08240 [4572-4625]  6.50000000000001e-06 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [759-922]  1.3e-22 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [1102-1353]  5.80000000000004e-93 PF00109 [3169-3420]  1.5e-91 PF00109 [5242-5492]  1.10000000000001e-89 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [1361-1478]  1.6e-48 PF02801 [3428-3543]  7.79999999999999e-47 PF02801 [5500-5617]  1.6e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [1642-1960]  5.80000000000004e-99 PF00698 [3713-4034]  7.40000000000007e-99 PF00698 [5780-6099]  1.5e-105 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [1640-1953]  2.99998750445706e-67 SSF52151 [3711-4015]  1.79999754022375e-62 SSF52151 [5778-6081]  5.20000089003336e-67 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [1768-1831]  2.2999993566538e-14 SSF55048 [3839-3905]  3.70000251046782e-13 SSF55048 [5906-5971]  3.00000067992871e-19 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [1105-1365]  G3DSA:3.40.47.10 [1366-1530]  G3DSA:3.40.47.10 [3172-3432]  G3DSA:3.40.47.10 [3433-3599]  G3DSA:3.40.47.10 [5244-5504]  G3DSA:3.40.47.10 [5505-5669]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1095-1477]  6.29998179434741e-103 SSF53901 [3162-3542]  1.09999184471405e-100 SSF53901 [5234-5670]  2.0000139277205e-100 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [758-931]  2.39999999999997e-117 G3DSA:3.40.50.720 [2576-2761]  7.99999999999993e-101 G3DSA:3.40.50.720 [2796-2983]  2.39999999999997e-117 G3DSA:3.40.50.720 [4641-4824]  7.99999999999993e-101 G3DSA:3.40.50.720 [4861-5039]  2.39999999999997e-117 G3DSA:3.40.50.720 [6406-6586]  2.09999999999996e-106 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1266-1282]  PS00606 [3333-3349]  PS00606 [5405-5421]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [1644-1942]  1.19999063421924e-118 SM00827 [3715-4015]  3.19999899046355e-109 SM00827 [5782-6081]  6.80004680300024e-126 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1013-1085]  2.49999811956465e-29 SM00823 [3078-3150]  4.09999599045784e-32 SM00823 [5144-5216]  2.49999811956465e-32 SM00823 [6689-6760]  1.20000117458134e-31 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [2009-2175]  4.69998262513189e-78 SM00826 [4082-4242]  4.69998262513189e-78 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [1105-1531]  SM00825 [3172-3598]  SM00825 [5244-5670]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [759-926]  9.00000407957274e-11 SM00822 [2796-2976]  1.40000506907309e-61 SM00822 [4860-5040]  2.1000026783403e-59 SM00822 [6405-6585]  2.99998750445706e-49 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [2486-2786]  SM00829 [4552-4850]  SM00829
SM00829   PKS_ER
IPR020845 AMP-binding, conserved site (Conserved_site)
 [170-181]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit