close all open/close all

CDS information : Gelda2_00090


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction39,094 / 49,401 / + [in whole cluster]
27,794 / 38,101 / + [in contig]
Location39094..49401 [in whole cluster]
27794..38101 [in contig]
TypeCDS
Length10,308 bp (3,435 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)GdmAII
GenegdmAII
gdmA2
Gene (GenBank)gdmAII
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase; modules 4-5
Reference
ACC
PmId
[12586396] Cloning and characterization of a gene cluster for geldanamycin production in Streptomyces hygroscopicus NRRL 3602. (FEMS Microbiol Lett. , 2003)
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)

close this sectionPKS/NRPS Module

4 methylmalonyl-CoA
5 methoxymalonyl-ACP
KS34..409
AT573..890
DH939..1101
KR1432..1612
ACP1718..1788
KS1811..2186
AT2349..2670
KR2973..3151
ACP3255..3325

close this sectionSequence

selected fasta
>polyketide synthase [GdmAII]
MANDEKLLNYLKRVTADLHQTRERLRKAEAATEEPIAIVGMGCRFPGGVTTPDGLWDLVA
DGRDAIAGFPEDRGWNLENLFDADPDSVGTSYVREGGFLTDAAEFDAEFFGISPREALAT
DPQQRLLLETAWETLEHAGIDPSSLEDSDVGVFTGLANGDYALTVDQVPEGFEGYLGLGG
AGSIASGRISYSLGLLGPAVTLDTGCSSSLVAMHLASYALRSGECSMALAGGVMVMATPG
GFVGFSRQRGLARDGRCKSFGEGADGTNWSEGVGLVLLERLSEAHRNGHPVLAVIRGTAV
NQDGASNGITAPNGPSQERVIRQALANAGLSLADVDAVEAHGTGTSLGDPIEAQALLATY
GQNRPEDQPLWLGSIKSNIGHTQAAAGVAGVIKMVQAMRHGVLPKTLHADEPTSKVDWTS
GAVSLLSEARPWPETGHPRRAGISSFGVSGTNAHVVLEQAPLEAAAPEVDVDEAGAPGLV
ATGGVVPWVLSGKTPAALRAQAERLVSHLESGDAPNAVDVGWSLATTRAALEHRAVILAT
DTEGGMATARALAEGRPDPLLVTGQTGTDGKTVFIFPGQGAQWVGMGAQLLNTSPVFAAR
LRECADALAPYTDWSLIDVITGTPDAPSLDRVDVVQPATFAVVVSLAALWQSVGIHPDAV
IGHSQGEIAAACVAGHLTLTNAAKIVTLRSQTIAHHLAGHGGMMSLATPADTIDLTNWHG
KLWIAAHNSPNATVIAGDTDALHQLHTHYTDQGTRARIIPVDYASHTGHVDTIKNQLQDV
LDGVTLEPGTIPWLSTVDGQWIEPSTVGDSYWYRNLRQTVQFEHTITTLADQGYRTFIEI
SPHPVLTTSIQETLEANDTSSTIVTGTLRRDDDTPTRLLTNLAHLTTNGTPVNWTTLFTG
TQPTRIPLPTYPFQHHHYWLPRNTNAGDIASAGLHDPGHPLLTAAVHLPDTGGTVLTGRL
SLTTHPWLADHTVSGAVLLPGAAMAELAIRAGDETDTPTLEELVIEQPLALPDSGFLDIR
VVVGGPDESGRRDVRIYSRAEEETAQWTEHATGTLAQDTTAPPSPAVAEWPPAGAEPVAV
EGLYEQMAEGGYDYGPTFQGLKAVWTRDGEVGEVFAEAALPEEQTEAAGRFGIHPALLDA
ALHASNYCLPGEPGSRMLLPFAWNGIRLHATGATSVRVHARYTEDGGLSVVLVDAAGGLV
ASIGSLVLREVDAAQLEALTSTSVNDSLWTVTWTEHTATTDEIRWGTVGDVSPVLAAAEA
PAFADVTEIATGPAIGMGTEIAGAEERPALVVADTTVWESRDADPITRARELATRALDLL
QRWVTLPELSETRLAVLTRGAMAVHDSSEVTDPAAAAIWGLVRSAQSEHPGRVHLIDTDG
HSDHALRSALPTALATDQPQLALRDNTLWAPRLTAAAPVGTPAQPLPLDPEGTVLITGGT
GTLGALTARHLITHHGARHLLLTSRQGPYAPGATDLTTELTELGATVHITACDTADRDQL
AALLANIPAAHPLTAVVHTAGTLDDALLTDLTPQRLDTVFRPKVDALTHLHDLTRDHDLT
AFVIYSSATGTLGTPGQANYAAANTYADALAHQRHATGLPATSLAWGLWETTSALTATMN
TEDRRRTHRGGVAPLTDDEGLVLLDTALTATHHPHLVPIKISPASLRADDTARPVPPLLR
HLVRRPTRRTAHTPAPADTLSLTRRLAALDHGERLRHLIELVRTEAAAVLGHPTIDSIGP
DQPFRDAGFDSLTAVELRNRLNTATGLRLPATVVFDYPTSAITAGYLRDELFGSTEAAPA
AVAGRGADADDPVVVVGMACRLPGRVTDPDGLWRLVADGEDGIGAFPTDRGWDLDTLFDP
DPDRVGATYVREGGFVAGATEFDADFFGISPREAVAMDPQQRLLLETAWETFEQAGIAPR
SVQGTDTGVFAGVIYHDYGTNAGELPEGSETYLSTGKSGSVVSGRVAYALGLTGPAVTVD
TACSSSLVAIHWAAKAVREGECSMALAGGVTVMSTPEGFVSFSHQRGLAPDGRSKSFGEG
ADGTTFSEGVGLVLLERLSEARRNGHEVLAVIAGTAVNQDGASNGLTAPNGPSQQRVIRQ
ALANAGLSATDIDAVEAHGTGTALGDPIEAQALLATYGQNRPADQPLWLGSLKSNIGHTQ
AAAGIAGLIKMIQAMRHGMLPRTLHADEPTTKVDWTSGAVSLLTEARPWPETGHPRRAGI
SSFGVSGTNAHLILEQAPEDAATAPEITEPEAPGLVATGGAVPWVLSAKSPTALRAQAER
LIAHLHAHPEIDPVDMGWSLATSRAALEHRAVVLATDLDQATAALTALSEGQPHPGLVTG
ETGSDGKTVFVFPGQGAQWQGMGAQLLNTSPVFATRLHECADALAPYTDWSLIDVITGAP
GAPSLDRVDVLQPTTFAIMVSLAALWQANGIHPDAVIGHSQGEIAAAHIAGHLTLTNAAK
IVTLRSQTIAHHLTGHGAMMSVLAPHTWVQEALTPWHEHLWIAAVNGPASVSVSGDPDAL
AEFGVTLSKAKVYRWQLPGVDFAGHSGHVDTIKDQLHHVLDGVTASPGNIAWMSTVDANW
TNPTHIDAHYWYRNLRDTVRFEEATRALLTHGHRVFIEISTHPVLTTAIQDTTETLPEVR
ATITGTLRRDDGGPDRVLAGLGGLFAAGVPVDWGALFASTGARRVPLPTYAFQHRHYWLE
PARTPTRAESADGSLWAAIEDGDAQSLARDLDVDAAALGTVLPALASWRRRSREDSLTDA
WRYRIGWTRVATADPQLSGRWLVLVPAVRAGSARVRAVLDGLAARGAEVVAAEVSETGRE
ALGDQVKSADGGAGVVSLLSWDDRADTEYGTVSTGTAATLAVAQALRDHGVTAPLWCVTS
GGVAVAGEAADPVQSAVWGFGAVLGLDHPDTFGGLIDLPAEGEGDDEALPDGLFAALSSP
EGEDQLAVRADGLFARRMVRDRDGSGSPWKPRGTVLVTGGTGGLGSHVARWLATSGADHV
VLLSRQGGDAPGAAELVADLAGVEVTLAACDVTDRDAVAAVLAEAERTHPLTAVVHTAGA
GLPSAPVTEVTTEEFAAVTGAKVRGALVLDELVGDRELDAFVLFSSGAGVWGSGGQAPYA
AGNAFLDGLAARRRAHGLAATAVAWGGWGGGLGMIDADGGDQWRRIGILPMDPAPALRAL
ARAVGGGLPNVIVADVDWARFVPGYTMARERPLLRQLPEVAEILAADTQGGGASRREVLL
GSLAELTGPEQEVFLTDLVRREAAAVLGHADGDAVEPERAFKDTGFDSLTAVELRNRINT
ATGLQLSPTVVFDYPKPTTLARRLRTELVPTVNGDVDGDGTADGGAAGADGREREIRRVL
ASVPLRRFHELGVLDALVRLADSAAGDLSGLRDLGDLGDLGDLGTAAEAETSALAELDAD
ELVSRAMRGTTFGND
selected fasta
>polyketide synthase [GdmAII]
ATGGCGAATGACGAAAAGCTCCTCAACTACCTCAAGCGGGTTACCGCCGACCTGCACCAG
ACGCGGGAACGGTTGCGCAAGGCCGAGGCGGCGACGGAGGAGCCGATCGCCATCGTCGGC
ATGGGCTGCCGCTTCCCGGGCGGCGTGACCACCCCGGACGGGCTGTGGGATCTGGTGGCC
GACGGCCGGGACGCGATCGCCGGGTTTCCGGAGGACCGCGGCTGGAACCTGGAGAACCTC
TTCGACGCCGACCCCGACTCCGTCGGCACCTCCTATGTGCGCGAGGGCGGCTTCCTCACC
GACGCGGCGGAGTTCGACGCCGAGTTCTTCGGCATCTCCCCGCGTGAGGCGCTGGCCACC
GATCCGCAGCAGCGGCTGCTGCTGGAGACCGCGTGGGAGACCCTCGAGCACGCGGGAATC
GACCCGAGTTCGCTGGAGGACAGCGACGTCGGCGTGTTCACCGGCCTGGCCAACGGCGAC
TACGCGCTGACCGTGGACCAGGTGCCGGAAGGCTTCGAGGGGTATCTGGGCCTTGGTGGC
GCGGGCAGCATCGCGTCCGGCCGTATCTCGTACTCGCTCGGTCTGCTCGGCCCGGCGGTC
ACTCTGGACACCGGGTGCTCCTCGTCCCTCGTGGCGATGCACTTGGCCAGTTATGCGCTC
CGGTCCGGGGAGTGCTCCATGGCGCTCGCCGGTGGGGTGATGGTGATGGCGACCCCTGGC
GGCTTCGTCGGATTCTCCCGGCAGCGGGGGCTGGCGCGCGACGGGCGCTGCAAGTCCTTC
GGTGAGGGCGCCGACGGCACCAACTGGTCCGAGGGCGTCGGTCTTGTGCTGCTGGAGCGG
CTGTCCGAAGCCCACCGCAACGGCCACCCGGTACTCGCGGTCATCCGTGGCACGGCCGTC
AACCAGGACGGCGCCTCCAACGGCATCACCGCGCCCAACGGGCCGTCCCAGGAACGGGTG
ATCCGGCAGGCGCTGGCGAACGCCGGACTGTCGCTGGCCGATGTGGACGCGGTCGAAGCC
CACGGCACCGGGACGAGTCTCGGCGACCCGATCGAGGCCCAGGCACTCCTGGCCACCTAC
GGTCAGAACCGCCCGGAGGATCAGCCGCTGTGGCTGGGCTCCATCAAGTCCAACATCGGC
CATACCCAGGCCGCCGCGGGTGTCGCGGGCGTCATCAAAATGGTCCAGGCCATGCGGCAC
GGCGTACTGCCCAAAACCCTCCACGCCGACGAGCCCACCAGCAAGGTCGACTGGACGTCA
GGTGCGGTGTCCCTGCTGTCCGAGGCCCGGCCCTGGCCGGAGACGGGACACCCCCGCCGC
GCCGGAATCTCCTCCTTCGGCGTCAGCGGGACGAACGCACACGTGGTCCTGGAACAGGCA
CCCCTGGAAGCGGCTGCACCCGAAGTAGACGTAGACGAGGCGGGCGCTCCTGGACTGGTG
GCCACGGGCGGCGTGGTGCCGTGGGTGCTCTCCGGTAAGACTCCTGCGGCGCTGCGGGCT
CAGGCGGAGCGTCTGGTCAGCCACCTGGAATCCGGGGACGCTCCGAATGCGGTGGACGTG
GGCTGGTCACTGGCCACCACCCGGGCGGCGTTGGAGCACCGCGCGGTCATCCTGGCCACG
GACACCGAAGGAGGCATGGCGACGGCGCGGGCTCTGGCGGAGGGACGGCCTGACCCGCTC
CTGGTCACCGGACAGACCGGAACAGACGGCAAAACCGTGTTCATCTTCCCCGGCCAAGGC
GCCCAATGGGTGGGCATGGGAGCCCAACTCCTCAACACCTCACCCGTCTTCGCCGCCCGC
CTGCGCGAGTGCGCCGATGCTCTAGCGCCGTATACCGACTGGTCGCTCATCGACGTCATC
ACCGGCACGCCCGACGCCCCATCGCTCGACCGTGTCGACGTCGTACAGCCCGCCACCTTC
GCCGTCGTCGTCTCCCTCGCCGCACTCTGGCAATCCGTGGGCATCCACCCCGACGCCGTC
ATCGGCCACTCCCAAGGCGAAATCGCCGCCGCCTGCGTCGCCGGACACCTCACCCTCACC
AACGCCGCCAAAATCGTCACCCTCCGCAGCCAGACCATCGCCCACCACCTCGCCGGACAC
GGCGGCATGATGTCCCTCGCCACCCCCGCCGACACCATCGACCTCACCAACTGGCACGGC
AAACTCTGGATCGCCGCACACAACAGCCCCAACGCCACCGTCATCGCAGGCGACACCGAC
GCCCTGCACCAACTCCACACCCACTACACCGACCAGGGCACCAGAGCCCGCATCATCCCC
GTCGACTACGCCTCCCACACCGGACACGTCGACACCATCAAAAACCAGCTACAAGACGTA
CTCGACGGCGTCACCCTCGAGCCCGGCACCATCCCCTGGCTCTCCACGGTCGACGGACAG
TGGATCGAGCCCAGCACGGTCGGCGACAGCTACTGGTACCGCAACCTCCGCCAGACCGTG
CAATTCGAGCACACCATCACCACCCTCGCCGACCAGGGCTACCGCACCTTCATAGAAATC
AGCCCCCATCCCGTCCTCACCACCTCCATCCAAGAAACCCTCGAAGCCAACGACACCTCC
AGCACCATCGTCACCGGCACCCTCCGCCGCGACGACGACACCCCCACCCGCCTCCTCACC
AACCTCGCCCACCTCACCACCAACGGAACACCAGTCAACTGGACCACCCTCTTCACAGGC
ACCCAACCCACCCGCATCCCCCTCCCCACCTACCCCTTCCAACACCACCACTACTGGCTC
CCCCGCAACACCAACGCAGGCGACATCGCCTCGGCCGGTCTCCACGACCCCGGGCACCCG
CTGCTCACCGCCGCCGTCCACCTCCCCGACACCGGTGGCACCGTTCTCACCGGGCGCCTC
TCCCTGACCACCCACCCCTGGCTGGCCGACCACACCGTGTCCGGCGCCGTCCTCCTCCCC
GGCGCCGCGATGGCCGAACTCGCCATCCGCGCCGGAGACGAGACCGACACCCCCACCCTG
GAAGAGCTGGTCATCGAGCAGCCACTGGCGCTGCCGGACAGTGGCTTCCTGGACATCCGG
GTGGTCGTGGGCGGCCCTGACGAGTCCGGGCGTCGGGACGTACGCATCTATTCCCGCGCC
GAAGAAGAAACCGCGCAGTGGACGGAGCACGCCACCGGCACGCTGGCTCAGGACACCACG
GCTCCTCCGTCGCCCGCCGTCGCCGAATGGCCACCCGCCGGTGCCGAGCCGGTGGCCGTC
GAGGGGCTGTACGAGCAGATGGCCGAGGGGGGCTACGACTACGGGCCGACCTTCCAGGGC
CTGAAGGCGGTATGGACCCGCGACGGCGAAGTGGGCGAGGTGTTCGCGGAGGCCGCGCTG
CCGGAGGAGCAGACGGAGGCCGCCGGCCGGTTCGGCATCCACCCGGCACTGCTGGACGCC
GCATTGCACGCGAGCAACTACTGCCTGCCCGGGGAACCCGGTAGCCGCATGCTGCTGCCG
TTCGCGTGGAACGGCATACGCCTGCACGCCACCGGTGCCACGTCGGTGCGCGTGCACGCC
CGTTACACCGAGGACGGCGGGCTCTCCGTGGTCCTGGTCGACGCAGCCGGCGGGCTGGTC
GCGTCGATCGGTTCGCTGGTTCTGCGGGAGGTCGACGCGGCGCAGCTCGAAGCGCTGACC
TCCACGTCGGTGAACGACTCACTCTGGACGGTCACTTGGACCGAACACACCGCCACCACG
GACGAGATCCGGTGGGGCACCGTCGGGGACGTCTCACCCGTCCTCGCCGCCGCCGAAGCC
CCGGCCTTCGCCGATGTCACAGAGATCGCCACGGGGCCCGCCATCGGGATGGGCACGGAG
ATCGCCGGGGCCGAGGAGCGGCCCGCGCTGGTCGTCGCCGACACCACCGTATGGGAGTCC
CGGGACGCCGACCCCATCACGCGGGCGCGGGAGCTGGCCACGCGGGCACTGGACCTGTTG
CAGCGGTGGGTGACCCTGCCTGAGCTGTCGGAAACACGGCTGGCGGTCCTCACGCGCGGT
GCGATGGCCGTACACGACTCGTCCGAGGTCACCGACCCTGCCGCGGCGGCGATCTGGGGT
CTGGTCCGCTCGGCCCAGTCCGAACACCCCGGCCGCGTCCACCTCATCGACACCGACGGC
CACTCGGACCACGCACTGCGCAGCGCACTGCCCACCGCACTCGCCACCGACCAGCCCCAA
CTGGCCCTCCGCGACAACACGCTCTGGGCGCCCCGGCTCACCGCCGCGGCACCCGTCGGC
ACACCGGCCCAGCCGCTCCCCCTCGACCCCGAGGGCACCGTTCTCATCACCGGCGGCACC
GGCACCCTGGGCGCCCTCACCGCCCGCCACCTCATCACCCACCACGGCGCCCGGCACCTG
CTGCTCACCAGCCGCCAGGGTCCCTACGCCCCCGGCGCCACGGACCTCACCACCGAACTC
ACCGAACTCGGCGCCACCGTCCACATCACCGCCTGCGACACCGCCGACCGCGACCAACTC
GCCGCCCTCCTCGCCAACATCCCGGCCGCCCACCCCCTCACCGCCGTCGTCCACACCGCC
GGAACCCTCGACGACGCCCTGCTCACCGACCTCACCCCGCAGCGCCTCGACACCGTCTTC
CGCCCCAAGGTCGACGCCCTCACCCACCTCCACGACCTCACCCGCGACCACGACCTGACC
GCCTTCGTCATCTACTCCTCCGCCACCGGCACCCTCGGCACCCCCGGCCAGGCCAACTAC
GCCGCCGCCAACACCTACGCCGACGCCCTCGCCCACCAGCGCCACGCCACCGGACTCCCC
GCCACCTCCCTCGCCTGGGGCCTATGGGAAACCACCAGCGCCCTCACCGCCACCATGAAC
ACCGAGGACCGCCGGCGCACCCACCGCGGCGGCGTGGCCCCCCTCACCGACGACGAGGGG
CTCGTCCTCCTCGACACGGCCCTCACCGCCACCCACCACCCCCACCTCGTCCCGATCAAG
ATCAGCCCGGCCTCCCTGCGAGCCGATGACACGGCGCGGCCCGTTCCCCCGCTCCTCCGC
CACCTCGTACGACGCCCCACGCGCCGCACGGCCCACACACCGGCCCCAGCGGACACCCTG
TCGCTCACCCGACGGCTCGCCGCCCTCGACCACGGCGAACGGCTACGGCACCTCATCGAG
CTCGTCCGCACCGAGGCGGCAGCCGTGCTCGGACACCCGACGATCGACAGCATCGGACCG
GACCAGCCCTTCCGGGACGCCGGGTTCGACTCGCTGACGGCGGTGGAACTGCGCAACCGC
CTCAATACGGCCACGGGACTGCGGCTCCCCGCGACCGTGGTGTTCGACTACCCGACCTCG
GCGATCACCGCCGGGTATCTGCGGGACGAGCTGTTCGGCTCGACGGAGGCGGCTCCGGCC
GCCGTCGCCGGGCGGGGGGCCGACGCGGACGACCCCGTGGTCGTCGTCGGCATGGCCTGC
CGACTCCCCGGACGGGTGACCGACCCGGACGGGCTGTGGCGGCTGGTGGCCGACGGGGAG
GACGGCATCGGGGCGTTCCCCACCGACCGCGGTTGGGATCTGGACACGCTGTTCGACCCC
GACCCGGACCGGGTGGGCGCGACCTACGTCCGCGAGGGCGGGTTCGTGGCGGGTGCCACC
GAGTTCGACGCGGACTTCTTCGGCATCTCCCCGCGTGAGGCCGTGGCGATGGACCCGCAG
CAACGGCTGTTGCTGGAGACCGCGTGGGAGACCTTCGAGCAGGCCGGTATCGCCCCGCGG
TCGGTGCAGGGCACCGACACCGGCGTGTTCGCCGGGGTCATCTACCACGACTACGGGACG
AACGCCGGTGAGCTGCCCGAGGGCTCGGAGACCTATCTGAGCACGGGCAAATCGGGGAGC
GTGGTGTCCGGGCGGGTCGCCTACGCACTGGGCCTGACCGGTCCCGCGGTGACGGTCGAC
ACGGCGTGCTCCTCCTCGCTGGTGGCCATCCACTGGGCGGCCAAGGCGGTGCGGGAGGGC
GAGTGCTCGATGGCCCTGGCCGGGGGCGTGACGGTGATGTCGACCCCGGAGGGGTTCGTG
AGCTTCTCGCACCAGCGTGGGCTCGCCCCCGATGGCCGCAGCAAGTCCTTCGGCGAGGGC
GCCGACGGCACCACCTTCAGCGAGGGTGTCGGGCTCGTGCTGCTGGAACGGCTCTCCGAG
GCCCGGCGCAACGGTCACGAGGTGCTGGCCGTGATCGCCGGTACGGCGGTCAACCAGGAC
GGCGCCAGCAACGGCCTCACCGCCCCCAACGGACCCTCCCAGCAACGGGTGATCCGGCAA
GCACTCGCGAACGCCGGGCTGTCGGCCACCGACATCGACGCCGTCGAAGCCCACGGCACC
GGCACCGCCCTCGGCGACCCCATCGAAGCCCAGGCACTCCTGGCCACCTACGGCCAGAAC
CGCCCCGCCGACCAGCCCCTCTGGCTGGGCTCGCTGAAGTCCAACATCGGCCACACCCAG
GCCGCCGCGGGCATCGCGGGCCTCATCAAGATGATCCAGGCCATGCGGCACGGCATGCTG
CCCAGGACACTCCACGCCGACGAGCCCACCACCAAGGTCGACTGGACATCGGGCGCGGTG
TCCCTGCTGACGGAGGCCCGCCCCTGGCCGGAGACCGGCCACCCACGCCGTGCCGGGATC
TCCTCCTTCGGCGTCAGCGGCACCAACGCCCATCTCATCCTCGAACAGGCCCCGGAAGAC
GCGGCCACCGCACCAGAAATCACGGAACCGGAGGCTCCCGGGCTGGTGGCCACGGGCGGC
GCGGTGCCGTGGGTGCTGTCCGCCAAGAGCCCCACGGCCCTGCGGGCGCAGGCCGAACGC
CTGATCGCCCACCTTCACGCCCACCCCGAGATCGACCCGGTGGACATGGGCTGGTCACTG
GCCACCAGCCGCGCCGCCCTGGAACACCGCGCGGTCGTCCTCGCCACCGATCTCGACCAG
GCGACCGCCGCCCTCACCGCTCTCAGCGAGGGGCAGCCGCACCCCGGCCTGGTCACCGGG
GAGACGGGCAGCGACGGCAAGACCGTCTTCGTCTTCCCCGGCCAGGGCGCCCAATGGCAA
GGCATGGGAGCCCAACTCCTCAACACCTCACCCGTCTTCGCCACCCGCCTCCACGAATGC
GCCGACGCCCTCGCCCCGTATACCGACTGGTCGCTCATCGACGTCATCACCGGCGCACCC
GGCGCGCCCAGCCTCGACCGTGTCGATGTCCTGCAGCCCACCACCTTCGCCATCATGGTC
TCCCTCGCCGCACTCTGGCAGGCCAACGGCATCCACCCCGACGCCGTCATCGGCCACTCC
CAAGGCGAAATCGCCGCCGCCCACATCGCCGGACACCTCACCCTCACCAACGCCGCCAAA
ATCGTCACCCTCCGCAGCCAGACCATCGCCCACCACCTCACCGGACACGGCGCCATGATG
TCCGTCCTCGCCCCCCACACCTGGGTCCAAGAAGCACTCACCCCCTGGCACGAACACCTG
TGGATCGCCGCCGTCAACGGCCCCGCCTCCGTATCCGTCTCCGGAGACCCCGACGCACTC
GCCGAATTCGGTGTCACCCTCTCCAAGGCGAAGGTCTACCGCTGGCAGTTGCCCGGGGTG
GACTTCGCCGGACACTCCGGACACGTCGACACCATCAAAGACCAGCTACACCACGTACTC
GACGGCGTCACCGCCTCCCCCGGCAACATCGCCTGGATGTCCACCGTCGACGCCAACTGG
ACCAACCCCACACACATCGACGCCCACTACTGGTACCGCAACCTCCGCGACACCGTCCGC
TTCGAAGAAGCCACCCGAGCCCTCCTCACCCACGGCCACCGCGTCTTCATCGAAATCAGC
ACCCACCCCGTCCTGACCACCGCCATCCAGGACACCACCGAAACCCTCCCCGAGGTCCGG
GCCACCATCACCGGAACGCTGCGCCGCGACGACGGCGGCCCCGACCGCGTTCTCGCGGGG
CTGGGAGGGCTGTTCGCGGCCGGGGTGCCGGTGGACTGGGGCGCCCTGTTCGCCAGTACC
GGGGCCCGTCGGGTGCCGCTGCCCACGTACGCCTTCCAGCACCGGCACTACTGGCTGGAG
CCCGCCAGGACACCGACGCGGGCCGAGAGCGCCGACGGCTCCCTGTGGGCGGCCATCGAG
GACGGAGACGCGCAGTCTCTCGCGCGGGATCTTGATGTGGACGCGGCGGCCCTCGGCACG
GTGCTGCCCGCGCTCGCCTCATGGCGTCGGCGCAGCCGGGAGGACTCCCTCACGGACGCA
TGGCGGTACCGGATCGGCTGGACCCGGGTGGCCACGGCCGACCCGCAGTTGTCGGGCCGG
TGGCTGGTGCTGGTCCCGGCCGTGCGGGCGGGCTCGGCGCGGGTCCGTGCGGTGCTGGAC
GGGCTGGCCGCGCGGGGCGCCGAGGTGGTGGCCGCCGAGGTCTCCGAAACCGGCCGGGAG
GCACTGGGCGACCAGGTCAAGTCGGCGGACGGCGGTGCCGGGGTGGTGTCCCTGCTCTCG
TGGGACGACCGCGCCGACACCGAGTACGGCACCGTGTCCACGGGCACCGCCGCGACGCTC
GCGGTGGCACAGGCGTTGCGGGACCACGGCGTCACCGCTCCGCTGTGGTGCGTCACCAGT
GGCGGGGTCGCGGTGGCCGGTGAGGCGGCCGACCCGGTGCAGTCCGCGGTGTGGGGATTC
GGCGCCGTACTCGGGCTCGACCACCCGGACACCTTCGGCGGCCTGATCGATCTGCCGGCC
GAAGGGGAGGGTGACGACGAGGCGTTGCCGGACGGGCTGTTCGCGGCGCTGTCGTCCCCC
GAGGGGGAGGACCAGCTCGCGGTGCGCGCCGACGGGCTGTTCGCACGCCGGATGGTGCGC
GACCGGGACGGCTCCGGCAGCCCCTGGAAGCCGCGCGGCACCGTGCTGGTCACGGGCGGC
ACCGGCGGGCTCGGTTCGCATGTGGCGCGCTGGCTCGCCACGAGCGGGGCGGACCATGTG
GTGCTGCTCAGCAGGCAGGGTGGTGACGCGCCGGGCGCGGCCGAACTGGTGGCGGACCTG
GCGGGGGTGGAGGTCACGCTCGCCGCGTGTGATGTGACCGACCGGGACGCCGTGGCCGCG
GTGCTGGCCGAAGCGGAGCGGACCCATCCGCTGACCGCGGTGGTGCACACCGCCGGTGCC
GGGCTGCCCTCGGCTCCGGTCACCGAGGTGACCACCGAGGAGTTCGCCGCCGTCACGGGG
GCGAAGGTGCGCGGCGCGCTGGTGCTGGACGAGCTCGTCGGCGACCGGGAGCTCGACGCG
TTCGTGCTGTTCTCCTCCGGCGCCGGTGTCTGGGGCAGCGGCGGGCAGGCCCCGTACGCG
GCGGGCAACGCCTTCCTGGACGGGCTGGCGGCCCGGCGGCGGGCACACGGGCTCGCGGCC
ACGGCGGTGGCGTGGGGCGGCTGGGGCGGCGGGCTCGGCATGATCGACGCCGACGGCGGC
GACCAGTGGCGCCGTATCGGCATCCTGCCGATGGATCCGGCGCCCGCGCTGCGTGCGCTG
GCGCGGGCCGTTGGGGGTGGTCTGCCGAATGTGATCGTCGCGGATGTCGACTGGGCGCGG
TTCGTGCCGGGCTACACGATGGCCCGGGAGCGGCCGCTGCTGCGGCAGTTGCCCGAGGTC
GCCGAGATCCTGGCGGCGGACACGCAGGGCGGGGGCGCATCGCGGCGGGAGGTGCTCCTG
GGCAGCCTGGCCGAGCTGACCGGCCCGGAGCAGGAGGTGTTCCTTACCGACCTGGTGCGG
CGTGAGGCGGCGGCCGTGCTCGGGCATGCGGACGGGGACGCGGTGGAGCCGGAGCGTGCG
TTCAAGGACACCGGGTTCGACTCGCTGACCGCGGTGGAGCTGCGCAACCGGATCAACACG
GCCACCGGTCTCCAGCTCTCCCCCACGGTGGTGTTCGACTATCCGAAGCCGACCACGCTG
GCGAGGAGGCTGCGTACGGAGTTGGTCCCCACGGTGAACGGGGACGTGGACGGGGACGGG
ACCGCGGACGGCGGGGCCGCCGGCGCGGACGGCCGCGAGCGGGAGATCCGGCGGGTGCTG
GCTTCGGTGCCACTGCGCCGCTTCCACGAACTGGGGGTGCTGGACGCGCTGGTGCGCCTC
GCGGACTCCGCGGCCGGCGACCTGAGCGGTCTGCGCGACCTGGGCGACCTGGGCGACCTG
GGCGACCTGGGCACCGCCGCGGAGGCGGAGACCTCCGCGCTCGCGGAGCTGGATGCCGAC
GAGCTGGTGAGCCGGGCGATGCGCGGCACGACCTTCGGAAACGACTGA
[4] KS34..409
[4] AT573..890
[4] methylmalonyl-CoA763..767
[4] DH939..1101
[4] KR1432..1612
[4] ACP1718..1788
[5] KS1811..2186
[5] AT2349..2670
[5] methoxymalonyl-ACP2542..2546
[5] KR2973..3151
[5] ACP3255..3325
[4] KS100..1227
[4] AT1717..2670
[4] methylmalonyl-CoA2287..2301
[4] DH2815..3303
[4] KR4294..4836
[4] ACP5152..5364
[5] KS5431..6558
[5] AT7045..8010
[5] methoxymalonyl-ACP7624..7638
[5] KR8917..9453
[5] ACP9763..9975

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [565-696]  G3DSA:3.40.366.10 [763-881]  G3DSA:3.40.366.10 [2339-2472]  G3DSA:3.40.366.10 [2542-2658]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [2973-3138]  2.19999999999997e-56 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1746-1761]  PS00012 [3283-3298]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1718-1788]  PS50075 [3255-3325]  PS50075
PS50075   ACP_DOMAIN
 [1721-1779]  3e-12 PF00550 [3258-3324]  1.6e-10 PF00550
PF00550   PP-binding
 [1711-1827]  2.30000440726534e-26 SSF47336 [3247-3331]  4.70000326671387e-19 SSF47336
SSF47336   ACP_like
 [1718-1791]  4.70000000000003e-43 G3DSA:1.10.1200.10 [3255-3328]  4.70000000000003e-43 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1432-1611]  6.19999999999994e-62 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-284]  2.90000000000003e-93 PF00109 [1811-2061]  3.49999999999995e-91 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-409]  1.6e-49 PF02801 [2069-2186]  6.6999999999999e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [573-890]  8.29999999999993e-100 PF00698 [2349-2670]  8.29999999999993e-97 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-26]  2.1e-13 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [571-861]  1.69998802370953e-67 SSF52151 [2347-2651]  2.19999900980707e-62 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [699-762]  2.2999993566538e-14 SSF55048 [2475-2541]  1e-12 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [33-295]  G3DSA:3.40.47.10 [296-461]  2.70000000000008e-130 G3DSA:3.40.47.10 [1810-2072]  G3DSA:3.40.47.10 [2073-2240]  2.70000000000008e-130 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-408]  3.99998544139406e-102 SSF53901 [1803-2239]  1.09999184471405e-101 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1433-1618]  2.59999999999995e-73 G3DSA:3.40.50.720 [2973-3152]  1.60000000000002e-72 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606 [1974-1990]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [575-872]  9.09992432541739e-119 SM00827 [2351-2651]  2.50000909916183e-109 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1719-1791]  1.10000150671643e-33 SM00823 [3256-3328]  5.50001754266469e-33 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [939-1101]  1.09999184471405e-85 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-462]  SM00825 [1813-2239]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1432-1612]  6.20001486442668e-59 SM00822 [2973-3151]  7.90003079443025e-50 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit