close all open/close all

CDS information : Gelda2_00160


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction68,915 / 68,640 / - [in whole cluster]
57,615 / 57,340 / - [in contig]
Locationcomplement(68640..68915) [in whole cluster]
complement(57340..57615) [in contig]
TypeCDS
Length276 bp (91 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative acyl carrier protein
Product (GenBank)GdmJ
Gene
Gene (GenBank)gdmJ
EC number
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
  • similar to FkbJ (ACP in methoxymalonyl-ACP biosynthesis pathway)
Reference
ACC
PmId
[12586396] Cloning and characterization of a gene cluster for geldanamycin production in Streptomyces hygroscopicus NRRL 3602. (FEMS Microbiol Lett. , 2003)
[17080682] Production of ansamycin polyketide precursors in Escherichia coli. (J Antibiot (Tokyo). , 2006)
Related Reference
ACC
Q8KUG2
NITE
Ansam_00160
PmId
[11960423] Identification of a set of genes involved in the formation of the substrate for the incorporation of the unusual "glycolate" chain extension unit in ansamitocin biosynthesis. (J Am Chem Soc. , 2002)
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
ACC
Q9KIE4
NITE
Asco_00100
PmId
[15179529] Engineered biosynthesis of 16-membered macrolides that require methoxymalonyl-ACP precursors in Streptomyces fradiae. (Appl Microbiol Biotechnol. , 2004)
ACC
Q06BL8
NITE
Gelda_00070
PmId
[18214443] The LuxR family members GdmRI and GdmRII are positive regulators of geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Arch Microbiol. , 2008)
Family/Domain
FD
IPR009081

close this sectionSequence

selected fasta
>putative acyl carrier protein [GdmJ]
MTISSEPGSHTAETVAQEVQQFLEQRTKQTWDPDTDLFGTGAVSSMFAMELVVHLESTFD
VVITGPDLALDNFRTVNAMTTMVLRLRGAQP
selected fasta
>putative acyl carrier protein [GdmJ]
GTGACCATCTCATCCGAGCCGGGCAGCCACACCGCCGAGACGGTGGCGCAGGAGGTGCAG
CAGTTCCTCGAACAGCGCACCAAGCAGACCTGGGACCCGGACACCGACCTGTTCGGCACC
GGCGCCGTGTCCTCGATGTTCGCCATGGAGCTGGTCGTGCACCTGGAGTCGACCTTCGAC
GTGGTGATCACCGGCCCCGACCTGGCGCTGGACAACTTCCGCACGGTCAACGCGATGACC
ACGATGGTCCTGCGGCTGCGCGGGGCACAGCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [14-82]  6.59999999999999e-07 PF00550
PF00550   PP-binding
 [13-85]  4.3e-13 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [7-87]  6.49999377884395e-12 SSF47336
SSF47336   ACP_like
SignalP No significant hit
TMHMM No significant hit