close all open/close all

CDS information : Gelda2_00200


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction74,922 / 73,858 / - [in whole cluster]
63,622 / 62,558 / - [in contig]
Locationcomplement(73858..74922) [in whole cluster]
complement(62558..63622) [in contig]
TypeCDS
Length1,065 bp (354 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative aminodehydroquinate synthase
Product (GenBank)GdmO
GenegdmO
Gene (GenBank)gdmO
EC number4.2.3.-
Keyword
  • AHBA
Note
Note (GenBank)
  • putative aminoDHQ synthase
Reference
ACC
PmId
[12586396] Cloning and characterization of a gene cluster for geldanamycin production in Streptomyces hygroscopicus NRRL 3602. (FEMS Microbiol Lett. , 2003)
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
O52549
NITE
Rifam_00280
PmId
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
ACC
P0A4Z4
PmId
[17586643] Functional characterization by genetic complementation of aroB-encoded dehydroquinate synthase from Mycobacterium tuberculosis H37Rv and its heterologous expression and purification. (J Bacteriol. , 2007)
[1910148] The Mycobacterium tuberculosis shikimate pathway genes: evolutionary relationship between biosynthetic and catabolic 3-dehydroquinases. (Mol Gen Genet. , 1991)
ACC
Q49BC4
NITE
Gelda2_00250
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
ACC
Q06BL4
NITE
Gelda_00110
PmId
[18214443] The LuxR family members GdmRI and GdmRII are positive regulators of geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Arch Microbiol. , 2008)

close this sectionSequence

selected fasta
>putative aminodehydroquinate synthase [GdmO]
MTTSTSSPAASSASPARQVVVGLAERSYTVHIGHGVQRLLPQVVAALGARRAVVVTARPA
EQTPDPGVPSLVVPARDGEAAKDLAAVTDLCRRFVGFGLTRSDVVVSCGGGTTTDTVGLA
AALYHRGTPVVHVPTSLLAQVDASVGGKTAVNLPEGKNLVGAYWQPAAVLCDLEHLKTLP
EREWRNGLGEIARCHFIGAPDLDGLPLLDQISASVTLKAGIVAADERDSGLRHLLNYGHT
LGHALERATGFALRHGEGVAIGTVFAGRLAGALGRIGPERVAEHHDVVARYGLPTALPPH
VSVSELVELMRLDKKATDGLTFVLDSPAGPGLVRGIAEDTVGATLAAMPRAPAW
selected fasta
>putative aminodehydroquinate synthase [GdmO]
TTGACCACGTCGACTTCCAGTCCGGCCGCCAGTTCCGCTTCCCCCGCCCGACAGGTCGTC
GTCGGGCTGGCCGAACGCTCCTACACCGTGCACATCGGACACGGTGTGCAGCGGCTGCTC
CCACAGGTGGTGGCCGCCCTGGGCGCGCGCAGGGCGGTGGTGGTCACCGCGCGGCCCGCC
GAGCAGACCCCCGACCCAGGAGTGCCCTCGCTCGTCGTACCCGCCCGCGACGGGGAGGCG
GCCAAGGACCTGGCCGCCGTGACCGATCTGTGCCGCCGGTTCGTCGGATTCGGACTGACC
CGCTCGGATGTGGTGGTGTCCTGTGGCGGCGGCACCACGACCGACACGGTGGGCCTGGCC
GCCGCCCTCTACCACCGGGGCACCCCGGTCGTACACGTGCCGACCTCGCTGCTCGCCCAG
GTGGACGCGAGCGTCGGCGGGAAGACCGCGGTGAATCTGCCCGAGGGCAAGAATCTGGTC
GGCGCCTACTGGCAGCCCGCGGCCGTGCTCTGCGACCTCGAACATCTGAAGACCCTGCCC
GAACGGGAATGGCGCAACGGCCTCGGTGAGATCGCCCGCTGCCACTTCATCGGCGCGCCC
GATCTCGACGGGCTGCCGCTGCTCGACCAGATCTCGGCCAGTGTGACGCTCAAGGCGGGC
ATCGTCGCCGCGGACGAGCGCGACTCGGGCCTGCGCCACCTCCTCAACTACGGACACACG
TTGGGGCATGCGCTGGAACGTGCCACCGGGTTCGCGCTGCGGCACGGGGAGGGAGTGGCC
ATCGGCACGGTTTTCGCCGGCCGGCTCGCCGGCGCGCTGGGGCGCATCGGCCCGGAGCGC
GTGGCCGAGCATCATGACGTGGTCGCCCGCTACGGCCTGCCGACCGCGCTGCCCCCGCAT
GTCTCCGTGTCCGAGCTGGTGGAGCTGATGCGCCTGGACAAGAAGGCCACCGACGGGCTG
ACGTTCGTCCTGGATAGCCCCGCGGGGCCCGGACTGGTGCGCGGGATCGCCGAGGACACC
GTCGGCGCCACCCTCGCGGCGATGCCCCGCGCGCCCGCATGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016037 3-dehydroquinate synthase AroB (Family)
 [17-353]  1.59998835313644e-75 PIRSF001455
PIRSF001455   DHQ_synth
SignalP No significant hit
TMHMM No significant hit