close all open/close all

CDS information : Gelda2_00205


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction75,200 / 75,003 / - [in whole cluster]
63,900 / 63,703 / - [in contig]
Locationcomplement(75003..75200) [in whole cluster]
complement(63703..63900) [in contig]
TypeCDS
Length198 bp (65 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.5 electron carrier
Productputative ferredoxin
Product (GenBank)
GenegdmFdx
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
[21682254] The missing C-17 O-methyltransferase in geldanamycin biosynthesis. (Org Lett. , 2011)
Related Reference
ACC
P18325
PmId
[1846297] Ferredoxins from two sulfonylurea herbicide monooxygenase systems in Streptomyces griseolus. (Biochemistry. , 1991)

close this sectionSequence

selected fasta
>putative ferredoxin
MVKVSVDQEKCCAAGHCALAAPEVFDQREEDGTVVLLDPRPPLALRDSVAEASFLCPAAA
IAVED
selected fasta
>putative ferredoxin
ATGGTGAAGGTCTCGGTGGATCAGGAGAAGTGCTGCGCGGCCGGGCATTGCGCGCTGGCG
GCGCCGGAGGTTTTCGACCAGCGGGAGGAGGACGGGACAGTGGTCCTGCTGGACCCGCGG
CCGCCGCTCGCGCTGCGCGACAGCGTCGCCGAGGCCTCGTTCCTGTGCCCGGCCGCCGCG
ATCGCGGTCGAGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001080 3Fe-4S ferredoxin (Family)
 [6-17]  3.4e-06 PR00352 [17-27]  3.4e-06 PR00352 [49-61]  3.4e-06 PR00352
PR00352   3FE4SFRDOXIN
SignalP No significant hit
TMHMM No significant hit