close all open/close all

CDS information : Gelda2_00220


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction79,478 / 76,590 / - [in whole cluster]
68,178 / 65,290 / - [in contig]
Locationcomplement(76590..79478) [in whole cluster]
complement(65290..68178) [in contig]
TypeCDS
Length2,889 bp (962 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional activator
Product (GenBank)GdmRI
Gene
Gene (GenBank)gdmRI
EC number
Keyword
Note
Note (GenBank)
  • putative transcriptional regulator; LuxR family
Reference
ACC
PmId
[12586396] Cloning and characterization of a gene cluster for geldanamycin production in Streptomyces hygroscopicus NRRL 3602. (FEMS Microbiol Lett. , 2003)
Related Reference
ACC
Q06BL2
NITE
Gelda_00130
PmId
[18214443] The LuxR family members GdmRI and GdmRII are positive regulators of geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Arch Microbiol. , 2008)
ACC
Q9ZGI0
NITE
Pikro_00180
PmId
[11344155] Characterization and analysis of the PikD regulatory factor in the pikromycin biosynthetic pathway of Streptomyces venezuelae. (J Bacteriol. , 2001)
[18245260] Enhanced heterologous production of desosaminyl macrolides and their hydroxylated derivatives by overexpression of the pikD regulatory gene in Streptomyces venezuelae. (Appl Environ Microbiol. , 2008)
[26608164] Interspecies Complementation of the LuxR Family Pathway-Specific Regulator Involved in Macrolide Biosynthesis. (J Microbiol Biotechnol. , 2016)

close this sectionSequence

selected fasta
>putative LuxR family transcriptional activator [GdmRI]
MTAEINSSLRRTPPQRGLMSMGLTDYQFELRDVLDAAARGNGGLLQVTGGPGVGKTSLLG
CLKEQAAESGAVCLTASGFADDTAIPFNIVERLIWSSAFMGELDVVARWRTAGERYSEAE
PGMLRSLVREISDVLHRIAGGKQLIIAIDDAEHADYPSLMCLLYIARHASGTRTLVVMTG
GQTHPLCAPTHGFHEFYKIKIDTLPESGVGYLLERHSDADLADRIRASCHAVSGGNPRLV
KALLRDHLQAAPGGPETAVTVGAEFQEAYRGCLLSHPALLQVAQALAVLDRYGSPWRVAN
LLECGQERAARAITIMNSAGLLEDGRFRHPAARYATLETLPAEDRARLSAKAAELLYADG
ADPIAVAELLVTADKTPDQKGVTVLWHAAQKNLDHGRTEEAIAGLRLAARADLGRREHMD
ILMALVGALWSSNPATAEPELDRLLAAIREEFPADIPERYLCFLLFMVLWFGRFSDGEEA
FKWLSGGGDTDNASSMAALRVTRQWATFLKPTLIHDFPDQPLSDGEVDGLWAANLEHGLQ
LSVGELGMEIGHFQDPRQVADFSPDAMHLLSPSNHFWFAYAYACRMVWALAARGEAETAD
RLCGALFTAADKLNMKTPGAVALSMRAYIRCRRGDFTSAIDFAGTALNSIPPRGWGVAIG
LPLSVLVAAHTAIGRLDEAERYLRYWVPKEMFDSVVGLEYLRARGQYCLATNRSYAALSD
FMVSGMLMDQWPVDFGDLAPWRIDAAEAYLHVQEPAEAKRLALEELKLSPDRPLSTRGRA
LRVLAMAEDPDKRRLLLYQSAKCLREHGDRFELARTLAELSQDFLSTGETQQARTTWHEA
QKLMDECGISAQHESRRDLVVDGAESSVDARLSEAAGESEEREPGASAEGAEQPVISEAE
WRVATLAASGMSNRQIAKSLYITVSTVEQHLTRIYRKLSVGNRQELSRRLWLLIGATGSS
SC
selected fasta
>putative LuxR family transcriptional activator [GdmRI]
ATGACTGCGGAGATCAACTCATCGCTCAGACGCACACCCCCACAGCGAGGACTGATGAGT
ATGGGACTGACAGATTATCAATTCGAGCTTCGCGACGTCCTCGACGCGGCAGCACGAGGC
AACGGCGGGCTTCTCCAAGTGACCGGGGGGCCCGGTGTCGGAAAGACCTCCTTATTGGGC
TGTCTGAAGGAACAGGCGGCCGAGTCGGGTGCGGTCTGTCTTACGGCGTCCGGATTCGCG
GACGACACCGCCATCCCGTTCAACATAGTGGAACGGCTGATCTGGTCCTCCGCGTTCATG
GGCGAATTGGACGTCGTGGCGCGCTGGAGGACTGCCGGAGAGCGGTATTCGGAGGCCGAA
CCCGGCATGCTGAGAAGCCTGGTCCGTGAAATATCCGATGTGCTGCACCGTATCGCGGGC
GGCAAGCAGCTGATCATCGCGATTGACGATGCCGAGCATGCCGACTACCCCTCCCTCATG
TGCCTTCTGTATATCGCCAGGCATGCGTCCGGCACTCGCACACTCGTCGTGATGACCGGC
GGGCAGACACATCCGTTGTGCGCCCCGACTCACGGCTTCCACGAGTTCTACAAGATCAAG
ATCGATACACTCCCGGAATCCGGGGTCGGATACCTGCTGGAGCGGCACAGCGACGCCGAC
CTGGCCGACCGGATCCGCGCCTCCTGCCACGCCGTCAGCGGTGGCAATCCCAGACTGGTC
AAGGCCCTGCTGCGCGACCATCTCCAAGCCGCTCCGGGCGGGCCGGAGACTGCTGTCACT
GTCGGTGCGGAGTTCCAGGAGGCCTATCGCGGGTGTCTGTTATCCCATCCGGCGTTGCTC
CAGGTGGCACAGGCCCTCGCGGTGCTGGACCGGTACGGCAGCCCGTGGCGGGTGGCCAAT
CTGCTCGAATGCGGCCAGGAACGCGCGGCCCGGGCCATCACCATCATGAACTCCGCGGGA
CTGCTGGAGGACGGACGTTTCCGGCACCCCGCGGCGCGATACGCCACGCTGGAGACGCTG
CCCGCGGAGGACCGGGCCCGCCTCAGCGCGAAAGCGGCCGAACTTCTGTATGCCGACGGG
GCCGACCCGATCGCGGTGGCGGAACTTCTGGTCACCGCCGATAAAACGCCCGACCAAAAA
GGCGTCACAGTGCTCTGGCACGCGGCCCAGAAGAATCTCGACCACGGCCGTACGGAGGAA
GCGATCGCCGGCCTGCGGCTCGCCGCCCGCGCGGACCTCGGCCGGCGGGAGCACATGGAC
ATTCTCATGGCGCTGGTCGGGGCGTTATGGTCCAGCAATCCGGCGACCGCCGAACCCGAA
CTGGACCGCCTGTTGGCCGCGATACGGGAGGAATTCCCCGCCGACATCCCCGAGCGGTAT
CTGTGCTTCCTGCTCTTCATGGTGCTGTGGTTCGGCCGGTTCAGCGATGGGGAAGAAGCC
TTCAAGTGGCTGTCGGGCGGTGGTGACACCGATAACGCGTCCAGCATGGCCGCTCTGCGG
GTGACCCGGCAGTGGGCCACCTTCCTTAAACCGACCCTGATCCATGACTTCCCCGACCAG
CCTCTCTCGGACGGGGAAGTCGACGGGCTGTGGGCGGCCAACCTGGAGCACGGTCTGCAG
CTGTCCGTCGGCGAACTGGGCATGGAGATCGGGCATTTCCAGGATCCCCGGCAGGTGGCG
GACTTCTCTCCCGATGCCATGCATCTGTTGTCGCCCTCCAATCACTTCTGGTTCGCGTAC
GCATACGCCTGCCGGATGGTCTGGGCATTAGCCGCGAGAGGAGAAGCGGAAACGGCGGAC
CGGCTGTGCGGCGCGCTTTTCACCGCGGCCGACAAGCTGAACATGAAGACGCCCGGCGCC
GTCGCCCTGTCCATGCGCGCCTACATCAGATGCCGCCGTGGGGACTTCACCTCGGCCATC
GATTTCGCCGGCACCGCACTGAATTCCATCCCCCCGCGCGGATGGGGCGTCGCCATCGGA
TTGCCGCTCTCCGTTCTGGTGGCGGCCCACACCGCCATCGGCAGACTCGATGAGGCCGAG
CGATATCTGCGTTACTGGGTGCCGAAGGAAATGTTCGACAGCGTTGTGGGATTGGAGTAC
CTCCGGGCTCGCGGACAGTACTGTCTGGCCACCAACCGCTCCTATGCCGCGCTGAGCGAT
TTCATGGTGAGCGGGATGCTGATGGACCAGTGGCCCGTGGACTTCGGCGACCTGGCGCCC
TGGCGCATCGACGCCGCCGAGGCGTATCTGCATGTCCAGGAGCCGGCGGAGGCCAAAAGA
CTCGCCCTGGAAGAGCTCAAGCTCTCGCCCGACCGCCCCTTGAGCACCCGTGGCCGAGCG
CTGCGCGTTCTGGCCATGGCCGAGGACCCGGACAAGCGCAGGCTGCTCCTCTATCAGTCC
GCCAAGTGTCTGCGCGAGCACGGCGACCGTTTCGAACTCGCCCGTACGCTCGCCGAGCTC
AGCCAGGACTTCCTCAGCACCGGAGAGACCCAACAGGCTCGCACCACCTGGCATGAGGCG
CAGAAGCTGATGGACGAGTGCGGGATCAGCGCCCAGCACGAGAGCCGCAGGGACCTGGTC
GTGGACGGCGCCGAGAGCTCCGTGGACGCTCGACTGTCGGAAGCCGCCGGGGAGTCCGAG
GAGAGAGAGCCCGGCGCATCGGCCGAAGGCGCAGAGCAGCCCGTTATCTCGGAGGCCGAG
TGGCGCGTGGCGACCCTGGCCGCGTCGGGGATGTCCAACCGGCAGATCGCCAAGAGCCTC
TACATCACGGTCAGCACCGTGGAGCAGCATCTGACGCGCATCTACCGCAAGCTCTCCGTG
GGAAATCGGCAGGAGCTGTCGCGTCGTCTGTGGCTGCTCATCGGAGCCACCGGATCGTCC
TCCTGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [896-910]  4.50000034739347e-08 PR00038 [910-926]  4.50000034739347e-08 PR00038 [926-938]  4.50000034739347e-08 PR00038
PR00038   HTHLUXR
 [894-947]  4.9e-13 PF00196
PF00196   GerE
 [893-950]  8.1000073432326e-20 SM00421
SM00421   HTH_LUXR
 [889-954]  PS50043
PS50043   HTH_LUXR_2
 [910-937]  PS00622
PS00622   HTH_LUXR_1
IPR011990 Tetratricopeptide-like helical (Domain)
 [586-858]  7.30000000000002e-14 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [893-950]  6.19999999999999e-18 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [874-953]  2.70000183580794e-15 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit