close all open/close all
Gelda2_00220 Gelda2_00220   last last

CDS information : Gelda2_00230


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction80,231 / 80,944 / + [in whole cluster]
68,931 / 69,644 / + [in contig]
Location80231..80944 [in whole cluster]
68931..69644 [in contig]
TypeCDS
Length714 bp (237 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative hydrolase
Product (GenBank)putative hydrolase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • similar to S. coelicolor SC2G4.19 (SC1103); ORF22
Reference
ACC
PmId
[12586396] Cloning and characterization of a gene cluster for geldanamycin production in Streptomyces hygroscopicus NRRL 3602. (FEMS Microbiol Lett. , 2003)
Family/Domain
FD
IPR006439

close this sectionSequence

selected fasta
>putative hydrolase [putative hydrolase]
MTVKGALFDFSGTLFRIESAESWLRTVLERSGTAVPDEDVLRYARNLEEAGALPGGAPPL
AVPPHLEEVWAVRDRGAEPHRAAFTGMAREVPLPRPELYDALYDRHMEPAAWRPYPDARE
VLGELRRRGVRIAVVSNIGWDLRPVFRAHGLDPLVDAYALSYEHGVQKPDPRLFQAACDA
LGVAPGDAVMVGDDRRADAGAAALGCRVHLVDHLPVDRRPDALRAVLGLPPDAATAP
selected fasta
>putative hydrolase [putative hydrolase]
GTGACCGTCAAGGGCGCGTTGTTCGACTTCTCCGGGACGCTGTTCCGAATCGAGTCCGCC
GAGTCCTGGCTCCGCACCGTGCTGGAGCGGAGCGGGACCGCGGTCCCGGACGAGGATGTC
CTACGGTACGCGCGGAACCTGGAGGAGGCCGGTGCGCTGCCCGGCGGCGCCCCGCCGCTC
GCGGTGCCGCCGCACCTGGAGGAGGTGTGGGCCGTACGGGACCGCGGCGCCGAGCCGCAC
CGGGCCGCCTTCACCGGTATGGCCCGCGAGGTGCCGCTGCCCCGCCCCGAGCTCTACGAC
GCCCTCTATGACCGCCATATGGAGCCCGCCGCCTGGCGGCCCTACCCCGACGCCCGCGAG
GTGCTGGGCGAGCTGCGCCGGCGCGGGGTGCGGATCGCGGTGGTCAGCAACATCGGCTGG
GATCTGCGCCCGGTCTTCCGCGCCCACGGCCTGGACCCGCTGGTGGACGCCTATGCGCTC
TCGTACGAGCACGGGGTGCAGAAGCCGGACCCGAGGCTGTTCCAGGCCGCGTGCGACGCG
CTGGGCGTGGCCCCGGGCGACGCGGTGATGGTGGGCGACGACCGCCGGGCGGACGCGGGA
GCGGCGGCCCTGGGCTGCCGGGTCCACCTGGTGGACCATCTCCCGGTGGACCGGCGTCCG
GACGCCCTGCGCGCGGTTCTCGGCCTGCCGCCGGACGCCGCCACGGCCCCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005833 Haloacid dehalogenase/epoxide hydrolase (Family)
 [3-14]  6.20000124972815e-12 PR00413 [125-138]  6.20000124972815e-12 PR00413 [155-171]  6.20000124972815e-12 PR00413 [173-193]  6.20000124972815e-12 PR00413 [200-213]  6.20000124972815e-12 PR00413
PR00413   HADHALOGNASE
IPR006402 HAD-superfamily hydrolase, subfamily IA, variant 3 (Family)
 [96-210]  9e-09 TIGR01509
TIGR01509   HAD-SF-IA-v3
IPR006439 HAD-superfamily hydrolase, subfamily IA, variant 1 (Family)
 [117-202]  1.6e-07 TIGR01549
TIGR01549   HAD-SF-IA-v1
IPR023214 HAD-like domain (Domain)
 [102-213]  4.29999999999999e-31 G3DSA:3.40.50.1000
G3DSA:3.40.50.1000   HAD-like_dom
 [1-213]  2.1000026783403e-37 SSF56784
SSF56784   HAD-like_dom
SignalP No significant hit
TMHMM No significant hit
Gelda2_00220 Gelda2_00220   last last