close all open/close all
first first   Gelda2_00250 Gelda2_00250

CDS information : Gelda2_00240


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction1,252 / 428 / - [in whole cluster]
1,252 / 428 / - [in contig]
Locationcomplement(428..1252) [in whole cluster]
complement(428..1252) [in contig]
TypeCDS
Length825 bp (274 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative MerR family transcriptional regulator
Product (GenBank)putative transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF1; similar to Streptomyces hygroscopicus GdnT encoded by GenBank Accession Number AF521894
Reference
ACC
Related Reference
ACC
Q848A6
NITE
Gelda_00220
Family/Domain
FD
IPR000551

close this sectionSequence

selected fasta
>putative MerR family transcriptional regulator [putative transcriptional regulator]
MFTIGDFARHGRVSVRMLRHYDATGLLRPAHVDPATGYRYYAAAQLSRLNRVIALKELGF
TLQQVRDIVDEKAGTEELRGMLRLRRAELEATVAAVAARLVQVEARLRSIESEGHMPTND
VVIKEIRAVRVAELTATATGFDPRDIGPVITPLYDELFRRLDAAGITPTGPGVAYYEDAP
EGGGAITVHAAVQVSAPLRDGEDLRILDLPPVDRAATIVHRGPMDAVVPTAQALAHWIDG
NGYRSSGYPREVNLECPENREEWVTELQTPVVEV
selected fasta
>putative MerR family transcriptional regulator [putative transcriptional regulator]
ATGTTCACCATCGGAGACTTCGCCCGGCACGGCCGCGTATCGGTCCGGATGCTGCGCCAC
TACGACGCCACCGGACTGCTGCGCCCGGCCCATGTCGACCCCGCCACCGGCTACCGCTAC
TACGCGGCCGCCCAGCTCAGCCGCCTGAACCGGGTCATCGCGCTCAAAGAGCTCGGCTTC
ACCCTCCAGCAGGTGCGGGACATCGTGGACGAGAAGGCCGGCACCGAGGAACTGCGCGGC
ATGCTGCGGTTGCGGCGGGCCGAGCTGGAAGCCACCGTGGCCGCCGTGGCGGCACGGCTG
GTGCAGGTCGAGGCGAGGCTCCGGTCGATCGAAAGCGAAGGACACATGCCCACGAACGAC
GTCGTCATCAAGGAGATCCGGGCAGTGCGGGTGGCGGAGCTCACCGCGACCGCCACCGGC
TTCGACCCCCGGGACATCGGCCCGGTCATCACACCCCTCTACGACGAGCTGTTCCGGCGC
CTCGATGCGGCGGGCATCACCCCGACGGGCCCCGGTGTCGCGTACTACGAGGACGCCCCG
GAAGGCGGCGGCGCCATCACCGTCCACGCCGCCGTCCAGGTCTCCGCCCCGCTCCGGGAC
GGTGAGGACCTCCGGATCCTCGATCTGCCGCCCGTCGACCGGGCCGCGACCATCGTCCAC
CGCGGCCCGATGGACGCCGTGGTGCCCACGGCCCAGGCCCTGGCCCATTGGATCGACGGC
AACGGCTACCGGTCGTCCGGCTACCCCCGGGAGGTCAACCTGGAGTGTCCGGAGAACCGC
GAGGAGTGGGTCACGGAACTCCAGACACCGGTGGTCGAGGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000551 Transcription regulator HTH, MerR (Domain)
 [1-71]  PS50937
PS50937   HTH_MERR_2
 [2-72]  1.99999636034521e-19 SM00422
SM00422   HTH_MERR
IPR009061 DNA binding domain, putative (Domain)
 [2-111]  6.90001478563507e-23 SSF46955
SSF46955   Putativ_DNA_bind
IPR010499 Bacterial transcription activator, effector binding (Domain)
 [119-272]  7.60000011115812e-15 SM00871
SM00871   AraC_E_bind
 [123-271]  1e-11 PF06445
PF06445   GyrI-like
IPR011256 Regulatory factor, effector, bacterial (Domain)
 [120-274]  8.49999291746323e-21 SSF55136
SSF55136   Bac_reg_effector
SignalP No significant hit
TMHMM No significant hit
first first   Gelda2_00250 Gelda2_00250