close all open/close all

CDS information : Gelda2_00250


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction1,364 / 2,413 / + [in whole cluster]
1,364 / 2,413 / + [in contig]
Location1364..2413 [in whole cluster]
1364..2413 [in contig]
TypeCDS
Length1,050 bp (349 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative aminodehydroquinate synthase
Product (GenBank)aDHQ synthase B
Geneahba-3
Gene (GenBank)
EC number4.2.3.-
Keyword
  • AHBA
Note
Note (GenBank)
  • ORF2; aminodehydroquinate synthase; AHBA biosynthetic pathway
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
O52549
NITE
Rifam_00280
PmId
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
ACC
P0A4Z4
PmId
[17586643] Functional characterization by genetic complementation of aroB-encoded dehydroquinate synthase from Mycobacterium tuberculosis H37Rv and its heterologous expression and purification. (J Bacteriol. , 2007)
[1910148] The Mycobacterium tuberculosis shikimate pathway genes: evolutionary relationship between biosynthetic and catabolic 3-dehydroquinases. (Mol Gen Genet. , 1991)
ACC
Q84G12
NITE
Gelda2_00200
PmId
[12586396] Cloning and characterization of a gene cluster for geldanamycin production in Streptomyces hygroscopicus NRRL 3602. (FEMS Microbiol Lett. , 2003)
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)

close this sectionSequence

selected fasta
>putative aminodehydroquinate synthase [aDHQ synthase B]
MTASAHPHTRVMVELGDRSYPVDIGPGVRHALSGVVAGLGAQRVAMVSARPDGWLPDPGV
PSMVLRARDGEADKSLATVEELCREFVRFGLTRSDAVVSCGGGTTTDVVGLAAALYHRGV
PVVHLPTSLLAQVDASVGGKTAVNLPEGKNLVGAFWQPSAVLCDTDYLETLPAAEMLNGY
GEIARCHFIGAGDLRGLALAEQIAASVALKASVVSADERDSGLRHVLNYGHTLGHALEIV
TDFRLRHGEGVAIGTVFAGRLALALGRIDEARAAEHLEVVRGYGLPFALPADADPGRLIE
VMRLDKKATDGLTFVLDGPGGPELVSGLAEETVATTLAGMDRAGSDNRR
selected fasta
>putative aminodehydroquinate synthase [aDHQ synthase B]
ATGACGGCGTCGGCTCATCCGCATACCCGCGTCATGGTGGAACTCGGCGACCGTTCCTAT
CCCGTCGACATCGGGCCGGGTGTCCGGCATGCGCTGTCCGGGGTCGTCGCGGGGCTCGGC
GCTCAGCGGGTGGCGATGGTCTCCGCCCGGCCGGACGGCTGGCTGCCCGACCCGGGCGTG
CCCTCGATGGTGCTGCGGGCCCGTGACGGGGAGGCGGACAAGTCGCTGGCCACGGTGGAG
GAGCTGTGCCGGGAGTTCGTCCGTTTCGGGCTGACCCGGTCGGATGCGGTTGTCTCCTGC
GGTGGCGGGACCACCACCGATGTCGTGGGTCTCGCGGCGGCGCTGTACCACCGGGGTGTG
CCCGTGGTGCATCTGCCGACCTCGCTGCTGGCCCAGGTGGACGCCAGCGTGGGCGGGAAG
ACGGCGGTGAATCTCCCCGAGGGGAAGAATCTGGTGGGTGCTTTCTGGCAGCCGTCCGCC
GTGTTGTGCGACACCGACTATCTGGAGACGCTGCCCGCAGCGGAAATGCTCAATGGATAT
GGGGAGATCGCCCGCTGCCACTTCATCGGCGCCGGTGATCTGCGCGGGCTGGCGCTGGCG
GAGCAGATCGCGGCGAGCGTGGCCCTGAAGGCATCGGTGGTCTCCGCGGATGAGCGGGAC
TCCGGGCTGCGTCATGTGCTCAATTACGGCCACACCTTGGGCCATGCGCTGGAAATCGTG
ACCGATTTCCGGCTGCGGCACGGTGAGGGGGTGGCGATCGGCACGGTTTTCGCCGGCCGT
CTGGCGCTGGCCCTGGGCCGGATCGACGAGGCGCGGGCGGCGGAGCATCTGGAGGTGGTG
CGGGGTTACGGGCTGCCGTTCGCGCTGCCCGCCGATGCCGATCCGGGTCGCCTGATCGAG
GTGATGCGGCTGGACAAGAAGGCGACGGATGGGCTCACCTTCGTCCTGGACGGTCCCGGC
GGTCCCGAGCTGGTCTCGGGCCTCGCGGAGGAGACGGTCGCCACGACGCTGGCCGGGATG
GACCGGGCCGGCTCGGACAACCGCCGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016037 3-dehydroquinate synthase AroB (Family)
 [9-345]  2.7000136937899e-82 PIRSF001455
PIRSF001455   DHQ_synth
SignalP No significant hit
TMHMM No significant hit