close all open/close all

CDS information : Gelda2_00260


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction3,224 / 2,427 / - [in whole cluster]
3,224 / 2,427 / - [in contig]
Locationcomplement(2427..3224) [in whole cluster]
complement(2427..3224) [in contig]
TypeCDS
Length798 bp (265 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative kanosamine kinase
Product (GenBank)kinase-like
Geneahba-1c
Gene (GenBank)
EC number
Keyword
  • AHBA
Note
Note (GenBank)
  • ORF3; AHBA biosynthetic pathway
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
O52554
NITE
Rifam_00340
PmId
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
[12207505] Characterization of the early stage aminoshikimate pathway in the formation of 3-amino-5-hydroxybenzoic acid: the RifN protein specifically converts kanosamine into kanosamine 6-phosphate. (J Am Chem Soc. , 2002)
ACC
Q8GGJ9
NITE
Gelda_00210
PmId
[16502293] Identification of AHBA biosynthetic genes related to geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Curr Microbiol. , 2006)

close this sectionSequence

selected fasta
>putative kanosamine kinase [kinase-like]
MTSGDPTLDLDLLAHHVTELCTGAPERLTGVGVAMPATLDATGTVTAWPGRPGWAGVDLG
GALSVLFGDAEVRCADDGDLAALAEAHEAGCPDLLYLGVGTGIGGGIVLNGKPVPGLGRG
SCEVGHLVVDRDGPLCDCGRRGCVQAAASGPATLRRAARRRGEDVTFAALRQAVADGKPW
AMAALRESGRALAAAVTGVCELVHPALVLIGGGFAAAMPELVAMVAERTAALGRPGHPMP
PVRPARLGGLSSLHGAVLLARGLPD
selected fasta
>putative kanosamine kinase [kinase-like]
ATGACGTCCGGCGACCCCACCCTCGACCTGGACCTGCTGGCGCATCACGTCACGGAGTTA
TGCACCGGCGCCCCCGAGCGGCTCACCGGCGTCGGGGTCGCGATGCCCGCCACCCTCGAT
GCCACCGGCACGGTCACCGCCTGGCCCGGCCGCCCCGGCTGGGCCGGAGTGGACCTGGGT
GGCGCGCTGTCCGTGCTTTTCGGCGACGCCGAGGTGCGCTGTGCCGACGACGGCGATCTG
GCCGCCCTCGCCGAAGCACACGAGGCCGGCTGCCCCGATCTGCTCTACCTCGGCGTCGGC
ACCGGGATCGGTGGTGGCATCGTGCTGAACGGAAAACCCGTCCCCGGCCTGGGCCGCGGC
TCCTGCGAAGTCGGCCACCTGGTCGTGGACCGCGACGGACCGCTGTGCGACTGCGGCCGG
CGCGGCTGCGTCCAGGCGGCGGCCTCGGGCCCGGCGACCCTGCGCCGGGCGGCGCGGCGG
CGGGGCGAGGACGTGACCTTCGCCGCGCTGCGCCAGGCCGTCGCCGACGGGAAGCCATGG
GCCATGGCGGCGCTGCGGGAGAGCGGCAGGGCCCTGGCCGCTGCCGTGACCGGCGTATGC
GAACTGGTCCATCCCGCGCTCGTGTTGATCGGCGGAGGGTTCGCCGCGGCGATGCCGGAG
CTCGTGGCGATGGTGGCCGAGCGGACGGCGGCGCTGGGGCGCCCGGGGCATCCGATGCCA
CCGGTCCGGCCCGCGCGACTGGGCGGGCTGTCCTCACTGCACGGCGCCGTTCTGCTGGCC
AGGGGGCTGCCGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000600 ROK (Family)
 [15-152]  5.5e-23 PF00480
PF00480   ROK
SignalP No significant hit
TMHMM No significant hit