close all open/close all

CDS information : Gelda2_00270


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction3,846 / 3,397 / - [in whole cluster]
3,846 / 3,397 / - [in contig]
Locationcomplement(3397..3846) [in whole cluster]
complement(3397..3846) [in contig]
TypeCDS
Length450 bp (149 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative aminodehydroquinate dehydratase
Product (GenBank)aDHQ dehydratase
Geneahba-4
Gene (GenBank)
EC number
Keyword
  • AHBA
Note
Note (GenBank)
  • ORF4; 5-deoxy-5-amino-3-dehydroquinate dehydratase; AHBA biosynthetic pathway
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
Q7BUF8
NITE
Rifam_00600
PmId
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
ACC
P43877
PmId
[8170389] Characterization of a 3-dehydroquinase gene from Actinobacillus pleuropneumoniae with homology to the eukaryotic genes qa-2 and QUTE. (Mol Microbiol. , 1994)
ACC
Q848A7
NITE
Gelda_00200
PmId
[16502293] Identification of AHBA biosynthetic genes related to geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Curr Microbiol. , 2006)

close this sectionSequence

selected fasta
>putative aminodehydroquinate dehydratase [aDHQ dehydratase]
MARCALSRLLLVNGPNLGILGKRQPEIYGTDTLQDIERWVGEEVAERGWKVDSYQFDGEA
EIIHTIQGNYDTVGAIINPAALMMAGWGLRDALANYPRPWIEVHLSNVWAREQFRHESVT
GPLAAGVIFGLGALGYRLAARALLEKVPD
selected fasta
>putative aminodehydroquinate dehydratase [aDHQ dehydratase]
ATGGCGAGGTGTGCATTGAGCAGACTGTTGTTGGTGAACGGACCGAATCTCGGAATACTC
GGGAAGCGACAGCCCGAGATCTACGGCACGGATACGCTGCAGGACATCGAGCGCTGGGTC
GGAGAAGAGGTCGCGGAGCGCGGCTGGAAAGTGGATTCCTACCAGTTCGACGGCGAAGCG
GAGATCATCCACACCATTCAGGGGAACTACGACACGGTCGGCGCCATCATCAATCCGGCC
GCGCTCATGATGGCCGGCTGGGGCCTTCGGGACGCACTGGCCAACTATCCGCGGCCCTGG
ATAGAGGTGCATCTGTCGAATGTCTGGGCCCGCGAGCAGTTCCGCCATGAGTCGGTGACG
GGCCCGCTGGCCGCGGGCGTCATCTTCGGGCTCGGCGCCCTGGGATACCGGCTCGCCGCA
CGCGCCCTGCTCGAGAAGGTGCCGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001874 Dehydroquinase, class II (Family)
 [1-148]  1.3000049540733e-45 SSF52304
SSF52304   DHquinase_II
 [7-147]  4.30000000000003e-51 G3DSA:3.40.50.9100
G3DSA:3.40.50.9100   DHquinase_II
 [10-129]  PD004527
PD004527   DHquinase_II
 [8-144]  5.40000000000002e-47 PF01220
PF01220   DHquinase_II
 [5-149]  6.90004508941104e-78 PIRSF001399
PIRSF001399   DHquinase_II
IPR018509 Dehydroquinase, class II, conserved site (Conserved_site)
 [12-29]  PS01029
PS01029   DEHYDROQUINASE_II
SignalP No significant hit
TMHMM No significant hit