close all open/close all

CDS information : Gelda2_00280


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction4,058 / 5,224 / + [in whole cluster]
4,058 / 5,224 / + [in contig]
Location4058..5224 [in whole cluster]
4058..5224 [in contig]
TypeCDS
Length1,167 bp (388 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative 3-amino-5-hydroxybenzoic acid synthase/UDP-3-keto-D-glucose aminotransferase
putative AHBA synthase/UDP-3-keto-D-glucose aminotransferase
Product (GenBank)AHBA synthase
Geneahba-B
Gene (GenBank)
EC number4.2.1.144
2.6.1.-
Keyword
  • AHBA
Note
  • bifunctional protein
Note (GenBank)
  • ORF5; 3-amino-5-hydroxybenzoate synthase; AHBA biosynthetic pathway
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
O52552
NITE
Rifam_00310
PmId
[9497318] 3-Amino-5-hydroxybenzoic acid synthase, the terminal enzyme in the formation of the precursor of mC7N units in rifamycin and related antibiotics. (J Biol Chem. , 1998)
[10433690] Crystal structure of 3-amino-5-hydroxybenzoic acid (AHBA) synthase. (Biochemistry. , 1999)
[12207505] Characterization of the early stage aminoshikimate pathway in the formation of 3-amino-5-hydroxybenzoic acid: the RifN protein specifically converts kanosamine into kanosamine 6-phosphate. (J Am Chem Soc. , 2002)
[21081954] The biosynthesis of 3-amino-5-hydroxybenzoic acid (AHBA), the precursor of mC7N units in ansamycin and mitomycin antibiotics: a review. (J Antibiot (Tokyo). , 2011)
ACC
Q848A8
NITE
Gelda_00190
PmId
[16502293] Identification of AHBA biosynthetic genes related to geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Curr Microbiol. , 2006)
[18214443] The LuxR family members GdmRI and GdmRII are positive regulators of geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Arch Microbiol. , 2008)

close this sectionSequence

selected fasta
>putative 3-amino-5-hydroxybenzoic acid synthase/UDP-3-keto-D-glucose aminotransferase [AHBA synthase]
MSNDVRLGSELPAWPQYGDEEREGLIRALDQGQWWRIGGGEVDAFEAEFAAAHGSEHALA
VTNGTHALELALEVLGIGAGTEVIVPAFTFISSSQAAQRLGAVAVPVDVDPDTYCIDPSA
VEAAIGPRTRAIMPVHMAGQMCDMDALGKLSADSGVPLIQDAAHAHGAQWRGKKVGELGS
VAAFSFQNGKLMTAGEGGAVLFPDAEMYERGFVRHSCGRPPSDRGYFHRTSGSNFRLNEF
SASVLRAQLGRLEDQITTREQRWPVLSRLLAEIPGVVPQSRDDRGDRNPHYMAMFRVPGL
TEERRAKIVDLLIERGVPAFVAFRAVYRTDAFWEMAAPDLTVDELARRCPHSEALTRDCL
WLHHRVLLGSEEQMHEVAAIVADVLASS
selected fasta
>putative 3-amino-5-hydroxybenzoic acid synthase/UDP-3-keto-D-glucose aminotransferase [AHBA synthase]
ATGAGCAATGATGTGCGCCTGGGATCCGAGCTGCCCGCATGGCCTCAGTATGGCGACGAG
GAGCGCGAGGGGCTCATTCGGGCCCTGGATCAGGGGCAGTGGTGGCGCATCGGGGGCGGT
GAGGTCGACGCCTTCGAGGCGGAGTTCGCCGCGGCCCACGGCAGCGAGCACGCCCTCGCG
GTCACCAACGGAACGCACGCGCTGGAACTCGCCCTCGAGGTACTCGGCATCGGAGCCGGC
ACCGAGGTGATCGTTCCCGCGTTCACCTTCATCTCGTCCTCGCAGGCCGCGCAGCGGCTG
GGCGCGGTGGCCGTTCCCGTGGACGTGGACCCGGACACCTACTGCATCGATCCGTCGGCG
GTCGAGGCGGCCATCGGCCCGAGGACCCGCGCGATCATGCCGGTGCACATGGCGGGTCAG
ATGTGCGACATGGACGCGCTGGGCAAGCTGTCCGCCGACTCGGGGGTGCCGCTGATCCAG
GACGCGGCCCACGCCCACGGAGCGCAGTGGCGCGGCAAGAAGGTCGGTGAGCTGGGCTCG
GTCGCCGCGTTCAGTTTTCAGAACGGGAAGCTTATGACCGCCGGTGAGGGCGGCGCCGTG
CTGTTCCCCGACGCCGAGATGTACGAGCGGGGCTTCGTCCGGCACAGCTGCGGACGTCCG
CCCTCCGACCGCGGCTACTTCCACCGCACCTCGGGCTCCAACTTCCGGCTGAACGAGTTC
TCCGCCTCGGTGCTGCGCGCCCAACTCGGCCGCCTGGAGGACCAGATCACCACGCGTGAG
CAGCGCTGGCCGGTGCTGAGCCGACTGCTCGCCGAGATCCCCGGTGTCGTACCGCAGTCG
CGCGACGACCGCGGTGACCGCAACCCGCACTACATGGCGATGTTCCGGGTGCCGGGTCTC
ACCGAGGAGCGCCGCGCGAAGATCGTCGACCTGCTCATCGAGCGCGGGGTGCCCGCGTTC
GTCGCCTTCCGCGCGGTCTACCGTACGGACGCATTCTGGGAGATGGCGGCGCCGGACCTG
ACGGTGGACGAGCTCGCCCGCCGCTGCCCGCACTCCGAGGCGCTCACCCGCGACTGCCTA
TGGCTGCACCACCGGGTGCTGCTGGGCAGCGAGGAGCAGATGCACGAAGTGGCCGCCATC
GTCGCCGACGTGCTCGCGAGCTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [1-388]  PIRSF000390
PIRSF000390   PLP_StrS
 [18-380]  2.20000000000002e-117 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [13-250]  1.10000000000001e-75 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [251-386]  7.29999999999999e-63 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [8-388]  2.2999842048857e-103 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit